KEGG   Homo sapiens (human): 148156Help
Entry
148156            CDS       T01001                                 

Gene name
ZNF558
Definition
(RefSeq) zinc finger protein 558
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    148156 (ZNF558)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148156 (ZNF558)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    148156 (ZNF558)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 zinc_ribbon_15 zf-C2HE HypA C1_4 XPA_N zf-LYAR zf-BED zf-met Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 148156
NCBI-ProteinID: NP_653294
HGNC: 26422
Ensembl: ENSG00000167785
Vega: OTTHUMG00000182196
Pharos: Q96NG5(Tdark)
UniProt: Q96NG5
Position
19p13.2
AA seq 402 aa AA seqDB search
MAAVILPSTAAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAVEFTQEEWALL
DPAQRTLYRDVMLENCRNLASLGCRVNKPSLISQLEQDKKVVTEERGILPSTCPDLETLL
KAKWLTPKKNVFRKEQSKGVKTERSHRGVKLNECNQCFKVFSTKSNLTQHKRIHTGEKPY
DCSQCGKSFSSRSYLTIHKRIHNGEKPYECNHCGKAFSDPSSLRLHLRIHTGEKPYECNQ
CFHVFRTSCNLKSHKRIHTGENHHECNQCGKAFSTRSSLTGHNSIHTGEKPYECHDCGKT
FRKSSYLTQHVRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYECSDCGKAFNNL
SAVKKHLRTHTGEKPYECNHCGKSFTSNSYLSVHKRIHNRWI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtcatcctgccctcgactgctgctccgtcttccctgttcccagcctctcag
caaaaaggacacacacagggcggagagctggttaatgagctcctgacaagctggctacgg
ggcttggtaaccttcgaggatgtggccgtggagttcacccaggaggagtgggcgttgctg
gaccctgcccaaaggacactgtacagggatgtgatgctggagaactgcaggaacctggcc
tcactagggtgtcgtgttaataaacccagtctgatatcccagttggaacaagacaagaag
gtggtgacagaggaaagaggaattctaccaagcacctgtccagatttggagactctactt
aaagccaaatggttaactcctaagaagaatgttttcagaaaagaacagtctaaaggtgta
aaaacggaaagaagtcatcgtggagtgaaactcaatgaatgtaatcagtgttttaaagtc
ttcagcacgaaatctaacctaactcagcacaagagaattcatactggagaaaaaccctat
gactgtagtcaatgtgggaagtccttcagtagcagatcttaccttactattcataagaga
atccataatggggagaaaccctatgaatgcaatcactgtgggaaagcatttagtgatccc
tcatcccttagactgcatttgagaattcacactggagaaaaaccctatgaatgtaaccag
tgttttcacgttttccgcaccagttgtaacctcaaaagccacaagaggattcacacgggg
gagaatcaccatgaatgtaatcagtgtggaaaagctttcagcacaaggtcctctctcact
gggcacaatagcattcatacaggggagaaaccttatgaatgtcacgattgtgggaaaacc
ttcaggaagagctcctatctgacacagcacgtaagaactcatactggagaaaaaccctat
gaatgtaacgagtgtgggaaatccttcagcagtagcttttctcttactgtgcacaagaga
atacataccggagagaaaccctacgagtgcagtgactgtggaaaagcctttaataatctc
tcagctgtgaagaaacacttaagaactcacactggagaaaaaccctatgaatgtaatcat
tgtgggaaatccttcacaagtaactcctatctttctgtgcacaagagaatacataataga
tggatatga

DBGET integrated database retrieval system