KEGG   Homo sapiens (human): 148170
Entry
148170            CDS       T01001                                 
Symbol
CDC42EP5, Borg3, CEP5
Name
(RefSeq) CDC42 effector protein 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BORG_CEP PBD
Other DBs
NCBI-GeneID: 148170
NCBI-ProteinID: NP_659494
OMIM: 609171
HGNC: 17408
Ensembl: ENSG00000167617
Pharos: Q6NZY7(Tbio)
UniProt: Q6NZY7
Position
19:complement(54465026..54473296)
AA seq 148 aa
MPVLKQLGPAQPKKRPDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEP
RAPPAGAPRSPPPPAVPQSAAPSPADPLLSFHLDLGPSMLDAVLGVMDAARPEAAAAKPD
AEPRPGTQPPQARCRPNADLELNDVIGL
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcccgtgctgaagcagctgggccccgcgcagcccaagaagcggcctgatcgcggcgcc
ctgtccatctccgcgccgctcggcgacttccggcacacgctgcacgtggggcgcggcggc
gacgccttcggggacacctcgttcctgagccgccacggcggcgggccgccccccgagccc
cgggcgccccccgcgggggccccgcgctccccgccgccgcccgccgtcccgcagtccgca
gcgccctcgcctgccgacccgctgctgtccttccacctggatctggggccctccatgctg
gacgcggtgctgggcgtcatggacgcggcgcgcccggaggcggctgccgccaagcccgac
gcggaaccccgccccgggacgcagcccccccaggcccgctgccgccccaacgcggacctc
gagctgaacgacgtcatcggcctctag

DBGET integrated database retrieval system