KEGG   Homo sapiens (human): 148229
Entry
148229            CDS       T01001                                 
Symbol
ATP8B3, ATPIK
Name
(RefSeq) ATPase phospholipid transporting 8B3
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    148229 (ATP8B3)
Enzymes [BR:hsa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     148229 (ATP8B3)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-GeneID: 148229
NCBI-ProteinID: NP_620168
OMIM: 605866
HGNC: 13535
Ensembl: ENSG00000130270
Pharos: O60423(Tdark)
UniProt: O60423
Position
19:complement(1782075..1812276)
AA seq 1300 aa
MGTGPAQTPRSTRAGPEPSPAPPGPGDTGDSDVTQEGSGPAGIRGGETVIRAGMGDSPGR
GAPERRHKAQPGRARKYEWRPEGPTSMGSLGQREDLQDEDRNSAFTWKVQANNRAYNGQF
KEKVILCWQRKKYKTNVIRTAKYNFYSFLPLNLYEQFHRVSNLFFLIIIILQSIPDISTL
PWFSLSTPMVCLLFIRATRDLVDDMGRHKSDRAINNRPCQILMGKSFKQKKWQDLCVGDV
VCLRKDNIVPADMLLLASTEPSSLCYVETVDIDGETNLKFRQALMVTHKELATIKKMASF
QGTVTCEAPNSRMHHFVGCLEWNDKKYSLDIGNLLLRGCRIRNTDTCYGLVIYAGFDTKI
MKNCGKIHLKRTKLDLLMNKLVVVIFISVVLVCLVLAFGFGFSVKEFKDHHYYLSGVHGS
SVAAESFFVFWSFLILLSVTIPMSMFILSEFIYLGNSVFIDWDVQMYYKPQDVPAKARST
SLNDHLGQVEYIFSDKTGTLTQNILTFNKCCISGRVYGPDSEATTRPKENPYLWNKFADG
KLLFHNAALLHLVRTNGDEAVREFWRLLAICHTVMVRESPRERPDQLLYQAASPDEGALV
TAARNFGYVFLSRTQDTVTIMELGEERVYQVLAIMDFNSTRKRMSVLVRKPEGAICLYTK
GADTVIFERLHRRGAMEFATEEALAAFAQETLRTLCLAYREVAEDIYEDWQQRHQEASLL
LQNRAQALQQLLGATAIEDRLQDGVPETIKCLKKSNIKIWVLTGDKQETAVNIGFACELL
SENMLILEEKEISRILETYWENSNNLLTRESLSQVKLALVINGDFLDKLLVSLRKEPRAL
AQNVNMDEAWQELGQSRRDFLYARRLSLLCRRFGLPLAAPPAQDSRARRSSEVLQERAFV
DLASKCQAVICCRVTPKQKALIVALVKKYHQVVTLAIGDGANDINMIKTADVGVGLAGQE
GMQAVQNSDFVLGQFCFLQRLLLVHGRWSYVRICKFLRYFFYKSMASMMVQVWFACYNGF
TGQPLYEGWFLALFNLLYSTLPVLYIGLFEQDVSAEQSLEKPELYVVGQKDELFNYWVFV
QAIAHGVTTSLVNFFMTLWISRDTAGPASFSDHQSFAVVVALSCLLSITMEVILIIKYWT
ALCVATILLSLGFYAIMTTTTQSFWLFRVSPTTFPFLYADLSVMSSPSILLVVLLSVSIN
TFPVLALRVIFPALKELRAKEEKVEEGPSEEIFTMEPLPHVHRESRARRSSYAFSHREGY
ANLITQGTILRRGPGVSSDIASESLDPSDEEAASSPKESQ
NT seq 3903 nt   +upstreamnt  +downstreamnt
atgggcactggccccgctcagactcccaggagcaccagagctggccctgagccaagccct
gccccaccaggacctggggacacgggtgactcagacgtgactcaggaaggctcaggtcct
gctggcatccgcggaggtgagacggtgatcagagctgggatgggagactccccaggcaga
ggggcacctgagaggaggcacaaggcccagcctggccgggctaggaagtatgaatggaga
ccagaaggccccaccagcatgggcagcctcggccagagagaagatctccaagatgaggac
aggaactcagcattcacctggaaggtccaggccaacaaccgtgcctacaacgggcagttc
aaggagaaggtgatcctgtgctggcaaaggaagaaatacaagaccaatgtcatccgcacg
gccaagtacaacttctactcgttcctgccgctgaacctgtacgagcagttccaccgcgtg
tccaacctgttcttcctcatcatcatcatcctgcagagcattcccgacatctccacgctg
ccctggttctcgctcagtacccctatggtctgcctcctcttcatccgtgccacccgggac
ctggtggacgacatggggagacacaagagtgacagagccatcaacaacagaccctgccag
attctgatggggaagagcttcaagcagaagaaatggcaggatctgtgcgtgggggatgtg
gtctgtctccgcaaggacaacatcgtcccagccgacatgctcttgctggccagcacggag
cccagcagcctgtgctatgtggagacggtggacattgacggggagaccaacttgaagttc
agacaggccctgatggtcacccacaaagaactggccactataaagaagatggcgtccttt
caaggcacagtgacgtgtgaggcgcctaacagtcggatgcaccacttcgtggggtgcctg
gaatggaatgacaagaaatactccctggacattggcaacctcctcctccgaggctgcagg
attcgcaacacagacacctgctatggactggtcatttatgctggttttgacacaaaaatt
atgaagaactgtggcaagatccatttgaagagaaccaagctggacctcctgatgaacaag
ctggtggttgtgatcttcatctccgtggtgcttgtctgcctggtgttggccttcggcttc
ggtttctcagtcaaagaattcaaagaccaccactactacctctcgggggtgcatgggagc
agcgtggccgcagagtccttcttcgtcttctggagcttcctcatcctgctcagcgtcacc
atcccgatgtccatgttcatcctgtccgagttcatctacctggggaacagcgtcttcatc
gactgggacgtgcagatgtactacaagccgcaggacgtgcctgccaaggcccgcagcacc
agcctcaacgaccacctgggccaggtggaatacatcttctcggacaagacgggcacgctc
acgcagaacatcttgaccttcaacaagtgctgcatcagcggccgcgtctatgggccggat
tcagaggccacgacccgacctaaggagaacccctacctctggaacaagttcgccgacggg
aagctgctcttccacaatgcggccctgctgcacctcgtgcggaccaacggggacgaggcc
gtgcgggagttctggcgcctgctggccatctgccacacggtgatggtgcgggagagcccc
cgtgagcgcccagaccagctgttgtaccaggcggcctcccccgacgagggggcgctggtc
accgcagcccggaacttcggctacgtgttcctgtcccgcacccaggacaccgtcacgatc
atggagctgggggaggaacgggtctaccaggtcctggccataatggacttcaacagcacg
cgcaaacggatgtcggtgctggttcgaaagccagagggcgccatctgcctgtacaccaag
ggcgccgacacggtcatcttcgaacgcttgcacaggaggggggcaatggaatttgccaca
gaggaggccttggctgcctttgcccaggagaccctgcggacactgtgcctggcctacagg
gaggtggctgaggacatttacgaggactggcagcagcgccaccaggaggccagcctcctg
ctgcagaaccgggcacaggccctgcaacagctgctgggagccacagccatcgaggacaga
ctccaggacggtgtccctgaaaccatcaaatgtctcaagaagagcaacatcaaaatatgg
gtgctcaccggggacaagcaggaaacggctgtgaacatcggcttcgcctgcgagctgctg
tcagagaatatgctcattctggaggagaaggagattagccgcatcctggagacctactgg
gaaaacagtaacaaccttctaaccagggagtccctgtcgcaggtcaagctggccttggtc
attaacggagacttcctggacaaactgctggtgtccctgcggaaggagccgcgcgccctg
gcgcagaacgtgaacatggacgaggcgtggcaggagctcggccagtccaggagggatttc
ctctacgccaggcgcctgtccctgctgtgccggaggttcgggctcccgctggctgcaccg
ccagcccaggactccagagcccgccgtagctccgaggtgctgcaggagcgcgccttcgtg
gacctggcgtccaagtgccaggcggtcatctgctgccgcgtgacgcccaagcagaaggcc
ctgatcgtggccctggtcaagaagtaccaccaggtggtgaccctggccatcggggacggt
gccaacgacatcaacatgatcaagaccgcggacgtgggcgtggggctggcgggccaggag
ggcatgcaggcagttcagaacagcgacttcgtgctcggccagttctgcttcctgcagcgc
ctcctgctggtgcacggccgctggtcctacgtgcggatctgcaagttcctgcgctacttc
ttctacaagagcatggccagcatgatggtgcaggtctggtttgcctgctacaacggcttc
accggccagcccctgtatgaaggatggttcctggctcttttcaacctcctgtacagcacc
ctgccagttctctacattgggctctttgagcaggacgtgagcgcagagcagagcctggag
aagccggagctgtacgtggtggggcagaaggacgagctcttcaactactgggtcttcgtc
caagccatcgcccatggtgtgaccacctctctggtcaacttcttcatgacactgtggatc
agccgcgacacggcgggacccgccagcttcagcgaccaccagtcctttgcggtcgtggtg
gccctgtcttgcctgctgtccatcaccatggaggtcattcttatcatcaagtactggacc
gccctgtgcgtggcgaccatcctcctcagccttggtttctacgccatcatgactaccacc
acccagagcttctggctcttcagagtatcccccacgaccttcccgtttctgtatgccgac
ctcagcgtgatgtcctctccctccatcctgctggtggtcctgctgagtgtgtccataaac
accttccctgtcctggccctccgagtcatcttcccagccctcaaggagctacgtgccaag
gaggagaaggtggaggagggccccagcgaggagattttcaccatggagcccttgcctcat
gtacaccgggagtctcgtgcccgccgttccagctatgctttctcccaccgtgagggatat
gcaaacctcatcactcagggcacaattctgcggaggggaccaggggtcagcagtgacata
gcatctgaatccctagacccatctgatgaagaggcagcttcgagcccaaaagagtcacag
tga

DBGET integrated database retrieval system