KEGG   Homo sapiens (human): 148423
Entry
148423            CDS       T01001                                 
Symbol
C1orf52, gm117
Name
(RefSeq) chromosome 1 open reading frame 52
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4660
Other DBs
NCBI-GeneID: 148423
NCBI-ProteinID: NP_932343
HGNC: 24871
Ensembl: ENSG00000162642
Pharos: Q8N6N3(Tdark)
UniProt: Q8N6N3
Position
1:complement(85249953..85259662)
AA seq 182 aa
MAAEEKDPLSYFAAYGSSSSGSSDEEDNIEPEETSRRTPDPAKSAGGCRNKAEKRLPGPD
ELFRSVTRPAFLYNPLNKQIDWERHVVKAPEEPPKEFKIWKSNYVPPPETYTTEKKPPPP
ELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKK
KK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcagcggaggagaaggaccctctgagctattttgcggcatacgggagcagcagctca
ggctcctcggacgaggaggataacatcgagccggaggagacgagtcgcagaaccccggat
ccggcgaagtcggcgggcggctgtaggaacaaggcggagaagcggctcccgggacctgac
gagctgtttaggagcgtgactcgcccggcctttctctacaatccgctcaacaaacagata
gactgggagaggcacgtcgtcaaggcgcctgaggagcctccaaaggaattcaaaatatgg
aagtcaaattatgtaccacctcctgagacctacaccactgagaagaagcctccgcctcca
gagcttgacatggcaataaaatggtctaacatatatgaggacaatggtgatgatgctcca
cagaatgctaagaaagctaggcttctaccagaaggggaggagacgttggaatcagatgat
gaaaaagatgagcatacttctaaaaagcgcaaagtagagccaggagaaccagcaaagaag
aaaaagtag

DBGET integrated database retrieval system