KEGG   Homo sapiens (human): 1485
Entry
1485              CDS       T01001                                 

Gene name
CTAG1B, CT6.1, CTAG, CTAG1, ESO1, LAGE-2, LAGE2B, NY-ESO-1
Definition
(RefSeq) cancer/testis antigen 1B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Pcc1
Other DBs
NCBI-GeneID: 1485
NCBI-ProteinID: NP_001318
OMIM: 300156
HGNC: 2491
Ensembl: ENSG00000184033
Vega: OTTHUMG00000024232
UniProt: P78358
Position
Xq28
AA seq 180 aa
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA
PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG
VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
NT seq 543 nt   +upstreamnt  +downstreamnt
atgcaggccgaaggccggggcacagggggttcgacgggcgatgctgatggcccaggaggc
cctggcattcctgatggcccagggggcaatgctggcggcccaggagaggcgggtgccacg
ggcggcagaggtccccggggcgcaggggcagcaagggcctcggggccgggaggaggcgcc
ccgcggggtccgcatggcggcgcggcttcagggctgaatggatgctgcagatgcggggcc
agggggccggagagccgcctgcttgagttctacctcgccatgcctttcgcgacacccatg
gaagcagagctggcccgcaggagcctggcccaggatgccccaccgcttcccgtgccaggg
gtgcttctgaaggagttcactgtgtccggcaacatactgactatccgactgactgctgca
gaccaccgccaactgcagctctccatcagctcctgtctccagcagctttccctgttgatg
tggatcacgcagtgctttctgcccgtgtttttggctcagcctccctcagggcagaggcgc
taa

DBGET integrated database retrieval system