KEGG   Homo sapiens (human): 148523
Entry
148523            CDS       T01001                                 
Symbol
CIART, C1orf51, CHRONO, GM129
Name
(RefSeq) circadian associated repressor of transcription
  KO
K21599  circadian-associated transcriptional repressor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148523 (CIART)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Others
    148523 (CIART)
SSDB
Motif
Pfam: Ciart
Other DBs
NCBI-GeneID: 148523
NCBI-ProteinID: NP_001287767
OMIM: 615782
HGNC: 25200
Ensembl: ENSG00000159208
Pharos: Q8N365(Tdark)
UniProt: Q8N365
Position
1:150282554..150287093
AA seq 385 aa
MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPG
PIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFA
QKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGT
LLQVEGMLKTWFPQIAAQKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHL
ALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGIGVILFLQHGV
QPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTLSPPSLPTLAR
KMTIGHREQQRSHPPVAADAHLLNL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggattctccatctagcgtttcttcctattcctcctactctctctcttcgtcttttccc
acctccccagtgaacagtgactttggcttcccctctgatagtgagagggaggacaagggg
gcccatgggcccaggccagacactgttgggcagaggggaggttcacggcccagcccgggt
cctatccgctgcaggcatcgatcgaaggtttccggtaaccagcatacaccatctcatccg
aaacagcggggttcggcttctcctatggcaggatctggggcgaaaagatcaagagatggt
gaactggagaccagtctaaacacccaaggttgtaccacagagggagacctgctgtttgcc
cagaagtgtaaagaactccaaggatttatacctcctctcacagacctactcaatgggctg
aagatgggtcgttttgagagaggattaagcagttttcagcagagtgtggcaatggacagg
atccagcgtattgtaggtgttttgcagaagccacagatgggggaacgttacctaggaacc
ttgctacaggtagaagggatgttaaagacttggtttccacaaatagctgcccagaagtca
tcattgggtggtggcaagcatcagctgaccaagcattttccaagccaccacagtgattca
gctgcttcctctcctgcatctcctatggaaaagatggaccagacacagctaggacatcta
gctttaaaaccaaagcagccttggcacctcacacaatggccagctatgaacctcacctgg
atccacaccactccaatttgcaacccccctctcagctccccaggtactatctcctttagc
catggtcctttaggcactggaaccggcattggcgtcattcttttcctccagcatggagtg
caacccttcacccactctgccccaaccaccccagtcccacctactacagcatctcctgtc
atccctggtgagcctatgaaactatctggagagggtcctcgttgctacagtttgccagta
actctgccatcagactggagctataccctatcccctcccagtctacccaccttggccaga
aagatgaccataggacaccgggagcagcagagaagccatcctccagttgctgctgatgct
catcttctcaacctctag

DBGET integrated database retrieval system