KEGG   Homo sapiens (human): 1486
Entry
1486              CDS       T01001                                 
Symbol
CTBS, CTB
Name
(RefSeq) chitobiase
  KO
K12310  Di-N-acetylchitobiase [EC:3.2.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    1486 (CTBS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.-
     1486 (CTBS)
SSDB
Motif
Pfam: Glyco_hydro_18
Other DBs
NCBI-GeneID: 1486
NCBI-ProteinID: NP_004379
OMIM: 600873
HGNC: 2496
Ensembl: ENSG00000117151
Pharos: Q01459(Tbio)
UniProt: Q01459 Q8TC97
Position
1:complement(84549611..84574440)
AA seq 385 aa
MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEV
FVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRA
SWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDV
AWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKM
SINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINS
SISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLD
YSGDAVAKQQTEEMWEVLKPKLLQR
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtcccggccgcagcttcgacgctggcgcctcgtctctagcccgccgagcggcgtcccg
ggtctagcgctgctggcgctgctggcgctgctggcgctgcggctcgcggccgggaccgac
tgcccatgcccggagcctgagctctgccgcccgattcgccaccatccagatttcgaggtc
tttgtgtttgatgttggacagaaaacttggaaatcttatgattggtcacagattacaact
gtggcaacatttggaaaatatgactcagaacttatgtgctacgctcattcaaaaggagcc
agagtagtacttaaaggagatgtatccttaaaggatatcattgatcctgctttcagagca
tcctggatagctcaaaaacttaatttggccaaaacacaatatatggatggaattaatata
gatatagagcaagaagttaattgtttatcacctgaatatgatgcattaactgctttagtc
aaagaaactacagactctttccatcgtgaaattgagggatcacaggtaacctttgatgta
gcttggtctccaaagaacatagacagaagatgctataattatactggaatcgcagatgct
tgtgacttcctctttgtgatgtcttatgatgaacaaagtcagatctggtcagaatgtatt
gcagcagccaatgctccctataatcagacattaactggatataatgactacatcaagatg
agcattaatcctaagaaacttgtaatgggtgttccttggtatggttatgattatacctgc
ctgaatctgtctgaggatcatgtttgtaccattgcaaaagtccctttccggggggctcct
tgtagtgacgctgcaggacgtcaggtgccctacaaaacgatcatgaagcaaataaatagt
tctatttctggaaacctatgggataaagatcagcgggctccttattataactataaagat
cctgctggccactttcatcaagtatggtatgataaccctcagagtatttctttaaaggca
acatatatacaaaactatcgcttacggggcattggcatgtggaatgcaaactgtcttgac
tactctggagatgctgtagccaaacagcaaactgaagaaatgtgggaagtcttaaagcca
aagctgttacagagatga

DBGET integrated database retrieval system