KEGG   Homo sapiens (human): 148641
Entry
148641            CDS       T01001                                 
Symbol
SLC35F3
Name
(RefSeq) solute carrier family 35 member F3
  KO
K15288  solute carrier family 35, member F3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    148641 (SLC35F3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   148641 (SLC35F3)
SSDB
Motif
Pfam: EamA SLC35F
Other DBs
NCBI-GeneID: 148641
NCBI-ProteinID: NP_001287774
HGNC: 23616
Ensembl: ENSG00000183780
Vega: OTTHUMG00000037929
Pharos: Q8IY50(Tdark)
UniProt: Q8IY50
Position
1:233904676..234324511
AA seq 421 aa
MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSR
AQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHV
CKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDV
SVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVA
SASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDI
PWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVI
AIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFA
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaagaagcactcggcccgggtggccccgctcagcgcctgcaacagtccggtcctgacc
cttaccaaagtggaaggggaggagcgcccccgggactccccgggcccggcggaggcccag
gcaccggccggggtggaggccggcgggagagcgagtcgccgctgctggacgtgctcccgg
gcgcaactcaagaagatcttctggggcgtggcggtcgtgctgtgcgtgtgctcctcgtgg
gcgggctccacgcagctcgccaagctgaccttcaggaagttcgacgcgcccttcaccctc
acgtggtttgccaccaactggaactttttattcttcccgttgtactacgtggggcacgtc
tgcaagtccacagagaagcagtctgtgaagcagcgatacagggaatgctgtcgatttttt
ggagacaatggcttgactttgaaggtgttttttaccaaggcagcaccctttggtgttctt
tggacactcacaaactacctgtacttacatgcaataaagaaaataaacactacggatgtc
tccgtgttgttctgctgcaacaaagcttttgtgttcttgctctcatggatcgttctcagg
gacagattcatgggagtgaggattgtggccgccatcctcgccatcgctggcattgtgatg
atgacctacgctgatggcttccacagccactccgtcatcggcatcgcactggtggtggcc
tcagcatcgatgtctgccctctacaaggttttgttcaagctcctcctgggcagtgctaag
tttggagaagccgccttatttttgtccatcttgggtgtgtttaacatcctcttcatcacc
tgcattcctattatcctctactttaccaaagtggaatactggagctcttttgatgacatt
ccatggggaaacctttgtggattttcagttcttttattgacattcaatattgtattaaat
tttggaattgccgttacatatcccactctgatgtctcttggaatcgtcctcagcatacct
gtgaatgcagtgattgatcactacaccagtcagatcgtcttcaatggggtccgggtcatc
gccatcatcatcatcggcctgggttttctcctcctgctcctgccagaggagtgggatgtc
tggttgatcaagctgctcacccgactcaaagtgaggaagaaggaggagcctgcagagggc
gctgccgacctgagctcaggacctcagagcaagaacagaagagcccgcccttccttcgcc
cgctaa

DBGET integrated database retrieval system