KEGG   Homo sapiens (human): 1487Help
Entry
1487              CDS       T01001                                 

Gene name
CTBP1, BARS, HADDTS
Definition
(RefSeq) C-terminal binding protein 1
  KO
K04496  C-terminal binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
hsa05200  Pathways in cancer
hsa05220  Chronic myeloid leukemia
Disease
H01773  4p deletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1487 (CTBP1)
   04330 Notch signaling pathway
    1487 (CTBP1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    1487 (CTBP1)
   05220 Chronic myeloid leukemia
    1487 (CTBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1487 (CTBP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Others
    1487 (CTBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C Cellsynth_D
Motif
Other DBs
NCBI-GeneID: 1487
NCBI-ProteinID: NP_001319
OMIM: 602618
HGNC: 2494
Ensembl: ENSG00000159692
Vega: OTTHUMG00000089259
Pharos: Q13363(Tbio)
UniProt: Q13363 X5D8Y5
Structure
PDB: 

Position
4p16.3
AA seq 440 aa AA seqDB search
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT
HWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA
PSPGQTVKPEADRDHASDQL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctcgcacttgctcaacaagggcctgccgcttggcgtccgacctccgatcatg
aacgggcccctgcacccgcggcccctggtggcattgctggatggccgggactgcacagtg
gagatgcccatcctgaaggacgtggccactgtggccttctgcgacgcgcagtccacgcag
gagatccatgagaaggtcctgaacgaggctgtgggggccctgatgtaccacaccatcact
ctcaccagggaggacctggagaagttcaaagccctccgcatcatcgtccggattggcagt
ggttttgacaacatcgacatcaagtcggccggggatttaggcattgccgtctgcaacgtg
cccgcggcgtctgtggaggagacggccgactcgacgctgtgccacatcctgaacctgtac
cggcgggccacctggctgcaccaggcgctgcgggagggcacacgagtccagagcgtcgag
cagatccgcgaggtggcgtccggcgctgccaggatccgcggggagaccttgggcatcatc
ggacttggtcgcgtggggcaggcagtggcgctgcgggccaaggccttcggcttcaacgtg
ctcttctacgacccttacttgtcggatggcgtggagcgggcgctggggctgcagcgtgtc
agcaccctgcaggacctgctcttccacagcgactgcgtgaccctgcactgcggcctcaac
gagcacaaccaccacctcatcaacgacttcaccgtcaagcagatgagacaaggggccttc
ctggtgaacacagcccggggtggcctggtggatgagaaggcgctggcccaggccctgaag
gagggccggatccgcggcgcggccctggatgtgcacgagtcggaacccttcagctttagc
cagggccctctgaaggatgcacccaacctcatctgcaccccccatgctgcatggtacagc
gagcaggcatccatcgagatgcgagaggaggcggcacgggagatccgcagagccatcaca
ggccggatcccagacagcctgaagaactgtgtcaacaaggaccatctgacagccgccacc
cactgggccagcatggaccccgccgtcgtgcaccctgagctcaatggggctgcctatagg
taccctccgggcgtggtgggcgtggcccccactggcatcccagctgctgtggaaggtatc
gtccccagcgccatgtccctgtcccacggcctgccccctgtggcccacccgccccacgcc
ccttctcctggccaaaccgtcaagcccgaggcggatagagaccacgccagtgaccagttg
tag

DBGET integrated database retrieval system