KEGG   Homo sapiens (human): 148789Help
Entry
148789            CDS       T01001                                 

Gene name
B3GALNT2, B3GalNAc-T2, MDDGA11
Definition
(RefSeq) beta-1,3-N-acetylgalactosaminyltransferase 2
  KO
K09654  beta-1,3-N-acetylgalactosaminyltransferase 2 [EC:2.4.1.313]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00515  Mannose type O-glycan biosynthesis
hsa01100  Metabolic pathways
Disease
H00120  Muscular dystrophy-dystroglycanopathy type A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    148789 (B3GALNT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    148789 (B3GALNT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.313  protein O-mannose beta-1,3-N-acetylgalactosaminyltransferase
     148789 (B3GALNT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Wide specificity
   148789 (B3GALNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T ZapB
Motif
Other DBs
NCBI-GeneID: 148789
NCBI-ProteinID: NP_689703
OMIM: 610194
HGNC: 28596
Ensembl: ENSG00000162885
Vega: OTTHUMG00000040468
Pharos: Q8NCR0(Tbio)
UniProt: Q8NCR0
Position
1q42.3
AA seq 500 aa AA seqDB search
MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTHYDVVVGVLSA
RNNHELRNVIRSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNITNP
VLNQEIEAFSLSEDTSSGLPEDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLY
QAEQEEALFIARFSPPSCGVQVNKLWYKPVEQFILPESFEGTIVWESQDLHGLVSRNLHK
VTVNDGGGVLRVITAGEGALPHEFLEGVEGVAGGFIYTIQEGDALLHNLHSRPQRLIDHI
RNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFNLLLKTDDDCY
IDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISK
DIVKWLASNSGRLKTYQGEDVSMGIWMAAIGPKRYQDSLWLCEKTCETGMLSSPQYSPWE
LTELWKLKERCGDPCRCQAR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaactggctggtgctgctgtgcccgtgtgtgctcggggccgcgctgcacctctgg
ctgcggctgcgctccccgccgcccgcctgcgcctccggggccggccctgcagatcagttg
gccttatttcctcagtggaaatctactcactatgatgtggtagttggcgtgttgtcagct
cgcaataaccatgaacttcgaaacgtgataagaagcacctggatgagacatttgctacag
catcccacattaagtcaacgtgtgcttgtgaagttcataataggtgctcatggctgtgaa
gtgcctgtggaagacagggaggatccttattcctgtaaactactcaacatcacaaatcca
gttttgaatcaggaaattgaagcgttcagtctgtccgaagacacttcatcggggctgcct
gaggatcgagttgtcagcgtgagtttccgagttctctaccccatcgttattaccagtctt
ggagtgttctacgatgccaatgatgtgggtttccagaggaacatcactgtcaaactttat
caggcagaacaagaggaggccctcttcattgctcgcttcagtcctccaagctgtggtgtg
caggtgaacaagctgtggtacaagcccgtggaacaattcatcttaccagagagctttgaa
ggtacaatcgtgtgggagagccaagacctccacggccttgtgtcaagaaatctccacaaa
gtgacagtgaatgatggagggggagttctcagagtcattacagctggggagggtgcattg
cctcatgaattcttggaaggtgtggagggagttgcaggtggttttatatatactattcag
gaaggtgatgctctcttacacaaccttcattctcgccctcaaagacttattgatcatata
aggaatctccatgaggaagatgccttactgaaggaggaaagcagcatctatgatgatatt
gtttttgtggatgttgtcgacacttatcgtaatgttcctgcaaaattattgaacttctat
agatggactgtggaaacaacgagcttcaatttgttgctgaagacagatgatgactgttac
atagacctcgaagctgtatttaataggattgtccaaaagaatctggatgggcctaatttt
tggtggggaaatttcagactgaattgggcagttgaccgaaccggaaagtggcaggagttg
gagtacccgagccccgcttaccctgcctttgcatgtgggtcaggatatgtgatctccaag
gacatcgtcaagtggctggcaagcaactcggggaggttaaagacctatcagggtgaagat
gtaagcatgggcatctggatggctgccataggacctaaaagataccaggacagtctgtgg
ctgtgtgagaagacctgtgagacaggaatgctgtcttctcctcagtattctccgtgggaa
ctgacggaactgtggaaactgaaggaacggtgcggtgatccttgtcgatgtcaagcaaga
taa

DBGET integrated database retrieval system