KEGG   Homo sapiens (human): 1488Help
Entry
1488              CDS       T01001                                 

Gene name
CTBP2
Definition
(RefSeq) C-terminal binding protein 2
  KO
K04496  C-terminal binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
hsa05200  Pathways in cancer
hsa05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1488 (CTBP2)
   04330 Notch signaling pathway
    1488 (CTBP2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1488 (CTBP2)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    1488 (CTBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1488 (CTBP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Others
    1488 (CTBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1488
NCBI-ProteinID: NP_001077383
OMIM: 602619
HGNC: 2495
Ensembl: ENSG00000175029
Vega: OTTHUMG00000019224
Pharos: P56545(Tbio)
UniProt: P56545
Structure
PDB: 

Position
10q26.13
AA seq 445 aa AA seqDB search
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgtggataagcacaaagtcaagagacagcgattggacagaatttgtgaaggt
atccgcccccagatcatgaacggccccctgcacccccgccccctggtggcgctgctggac
ggccgcgactgcactgtggagatgcccatcctgaaggacctggccactgtggccttctgt
gacgcgcagtcgacgcaggaaatccacgagaaggttctaaacgaagccgtgggcgccatg
atgtaccacaccatcaccctcaccagggaggacctggagaagttcaaggccctgagagtg
atcgtgcggataggcagtggctatgacaacgtggacatcaaggctgccggcgagctcgga
attgccgtgtgcaacatcccgtctgcagccgtggaagagacagcggactctaccatctgc
cacatcctcaacctgtaccggaggaacacgtggctgtaccaggcactgcgggaaggcacg
cgggttcagagcgtggagcagatccgcgaggtggcctcgggagcggcccgcatccgtggg
gagacgctgggcctcattggctttggtcgcacggggcaggcggttgcagttcgagccaag
gcctttggattcagcgtcatattttatgacccctacttgcaggatgggatcgagcggtcc
ctgggcgtgcagagggtctacaccctgcaggatttgctgtatcagagcgactgcgtctcc
ttgcactgcaatctcaacgaacataaccaccacctcatcaatgactttaccataaagcag
atgaggcagggagcattccttgtgaacgcagcccgtggcggcctggtggacgagaaagcc
ttagcacaagccctcaaggagggcaggatacgaggggcagccctcgacgtgcatgagtca
gagcccttcagctttgctcagggtccgttgaaagatgccccgaatctcatctgcactcct
cacactgcctggtacagtgagcaggcgtcactggagatgagggaggcagctgccaccgag
atccgccgagccatcacaggtcgcatcccagaaagcttaagaaattgtgtgaacaaggaa
ttctttgtcacatcagcgccttggtcagtaatagaccagcaagcaattcatcctgagctc
aatggtgccacatacagatatccgccaggcatcgtgggtgtggctccaggaggacttcct
gcagccatggaagggatcatccctggaggcatcccagtgactcacaacctcccgacagtg
gcacatccttcccaagcgccctctcccaaccagcccacaaaacacggggacaatcgagag
caccccaacgagcaatag

DBGET integrated database retrieval system