KEGG   Homo sapiens (human): 1491
Entry
1491              CDS       T01001                                 

Gene name
CTH
Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00270  Cysteine and methionine metabolism
hsa00450  Selenocompound metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Disease
H00182  Cystathioninuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    1491 (CTH)
   00270 Cysteine and methionine metabolism
    1491 (CTH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    1491 (CTH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1491 (CTH)
Enzymes [BR:hsa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     1491 (CTH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1491 (CTH)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 GDC-P
Other DBs
NCBI-GeneID: 1491
NCBI-ProteinID: NP_001893
OMIM: 607657
HGNC: 2501
Ensembl: ENSG00000116761
Vega: OTTHUMG00000009352
Pharos: P32929(Tbio)
UniProt: P32929
Structure
PDB: 

Position
1p31.1
AA seq 405 aa
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEY
SRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRY
FRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHG
DIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQ
NSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQH
ELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVL
KNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcaggaaaaagacgcctcctcacaaggtttcctgccacacttccaacatttcgccacg
caggcgatccatgtgggccaggatccagagcaatggacctccagggctgtagtgcccccc
atctcactgtccaccacgttcaagcaaggggcgcctggccagcactcgggttttgaatat
agccgttctggaaatcccactaggaattgccttgaaaaagcagtggcagcactggatggg
gctaagtactgtttggcctttgcttcaggtttagcagccactgtaactattacccatctt
ttaaaagcaggagaccaaattatttgtatggatgatgtgtatggaggtacaaacaggtac
ttcaggcaagtggcatctgaatttggattaaagatttcttttgttgattgttccaaaatc
aaattactagaggcagcaattacaccagaaaccaagcttgtttggatcgaaacccccaca
aaccccacccagaaggtgattgacattgaaggctgtgcacatattgtccataagcatgga
gacattattttggtcgtggataacacttttatgtcaccatatttccagcgccctttggct
ctgggagctgatatttctatgtattctgcaacaaaatacatgaatggccacagtgatgtt
gtaatgggcctggtgtctgttaattgtgaaagccttcataatagacttcgtttcttgcaa
aactctcttggagcagttccatctcctattgattgttacctctgcaatcgaggtctgaag
actctacatgtccgaatggaaaagcatttcaaaaacggaatggcagttgcccagttcctg
gaatctaatccttgggtagaaaaggttatttatcctgggctgccctctcatccacagcat
gagttggtgaagcgtcagtgtacaggttgtacagggatggtcaccttttatattaagggc
actcttcagcatgctgagattttcctcaagaacctaaagctatttactctggccgagagc
ttgggaggattcgaaagccttgctgagcttccggcaatcatgactcatgcatcagttctt
aagaatgacagagatgtccttggaattagtgacacactgattcgactttctgtgggctta
gaggatgaggaagacctactggaagatctagatcaagctttgaaggcagcacaccctcca
agtggaagtcacagctag

DBGET integrated database retrieval system