KEGG   Homo sapiens (human): 149111
Entry
149111            CDS       T01001                                 

Gene name
CNIH3, CNIH-3
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 3
  KO
K20368  protein cornichon
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    149111 (CNIH3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    149111 (CNIH3)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    149111 (CNIH3)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   149111 (CNIH3)
SSDB
Motif
Pfam: Cornichon
Other DBs
NCBI-GeneID: 149111
NCBI-ProteinID: NP_689708
HGNC: 26802
Ensembl: ENSG00000143786
Vega: OTTHUMG00000037634
Pharos: Q8TBE1(Tdark)
UniProt: Q8TBE1
Position
1q42.12
AA seq 160 aa
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI
CFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPP
VVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
NT seq 483 nt   +upstreamnt  +downstreamnt
atggccttcactttcgctgcgttctgctacatgctgtctctggtgctgtgcgctgcgctc
atcttcttcgccatctggcacataattgcctttgatgagttaaggacagattttaagagc
cccatagaccagtgcaatcctgttcatgcgagggaacggttgaggaacatcgagcgcatc
tgcttccttctgcgaaagctggtgctgccagaatactccatccatagcctcttctgcatt
atgttcctgtgtgcgcaagagtggctcacgctggggctgaatgtccctctacttttctat
cacttctggaggtatttccactgtccagcagatagctcagaactagcctacgacccaccg
gtggtcatgaatgccgacactttgagttactgtcagaaggaggcctggtgtaagctggcc
ttctatctcctctccttcttctactacctttactgcatgatctacactttagtgagctct
taa

DBGET integrated database retrieval system