KEGG   Homo sapiens (human): 149233
Entry
149233            CDS       T01001                                 
Symbol
IL23R
Name
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01557  IL12/23 to Jak-STAT signaling pathway
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
H01466  Ulcerative colitis
H01476  Behcet disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    149233 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    149233 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    149233 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    149233 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    149233 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    149233 (IL23R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   149233 (IL23R)
SSDB
Motif
Pfam: IL12p40_C IL6Ra-bind fn3 Lep_receptor_Ig
Other DBs
NCBI-GeneID: 149233
NCBI-ProteinID: NP_653302
OMIM: 607562
HGNC: 19100
Ensembl: ENSG00000162594
Pharos: Q5VWK5(Tbio)
UniProt: Q5VWK5
Structure
Position
1:67138637..67265903
AA seq 629 aa
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgaatcaggtcactattcaatgggatgcagtaatagccctttacatactcttcagctgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggaaacttcatttttataaaaatggcatcaaagaaagatttcaaatcacaaggatt
aataaaacaacagctcggctttggtataaaaactttctggaaccacatgcttctatgtac
tgcactgctgaatgtcccaaacattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatattcctgatgaagtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggta
catgtgaagagtttagagacagaagaagagcaacagtatctcacctcaagctatattaac
atctccactgattcattacaaggtggcaagaagtacttggtttgggtccaagcagcaaac
gcactaggcatggaagagtcaaaacaactgcaaattcacctggatgatatagtgatacct
tctgcagccgtcatttccagggctgagactataaatgctacagtgcccaagaccataatt
tattgggatagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaaccaaacttggaatgttaaagaatttgacaccaattttacatatgtgcaacagtca
gaattctacttggagccaaacattaagtacgtatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcagccttggagttcactgttttttcataaaacacctgaaacagttccc
caggtcacatcaaaagcattccaacatgacacatggaattctgggctaacagttgcttcc
atctctacagggcaccttacttctgacaacagaggagacattggacttttattgggaatg
atcgtctttgctgttatgttgtcaattctttctttgattgggatatttaacagatcattc
cgaactgggattaaaagaaggatcttattgttaataccaaagtggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaatagtgaacttatgaat
aataattccagtgagcaggtcctatatgttgatcccatgattacagagataaaagaaatc
ttcatcccagaacacaagcctacagactacaagaaggagaatacaggacccctggagaca
agagactacccgcaaaactcgctattcgacaatactacagttgtatatattcctgatctc
aacactggatataaaccccaaatttcaaattttctgcctgagggaagccatctcagcaat
aataatgaaattacttccttaacacttaaaccaccagttgattccttagactcaggaaat
aatcccaggttacaaaagcatcctaattttgctttttctgtttcaagtgtgaattcacta
agcaacacaatatttcttggagaattaagcctcatattaaatcaaggagaatgcagttct
cctgacatacaaaactcagtagaggaggaaaccaccatgcttttggaaaatgattcaccc
agtgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttggggatc
gtgaatgaggagttgccatctattaatacttattttccacaaaatattttggaaagccac
ttcaataggatttcactcttggaaaagtag

DBGET integrated database retrieval system