KEGG   Homo sapiens (human): 149233Help
Entry
149233            CDS       T01001                                 

Gene name
IL23R
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
H01466  Ulcerative colitis
H01476  Behcet disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    149233 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    149233 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    149233 (IL23R)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    149233 (IL23R)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    149233 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    149233 (IL23R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   149233 (IL23R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 IL12p40_C Lep_receptor_Ig
Motif
Other DBs
NCBI-GeneID: 149233
NCBI-ProteinID: NP_653302
OMIM: 607562
HGNC: 19100
Ensembl: ENSG00000162594
Vega: OTTHUMG00000009092
Pharos: Q5VWK5(Tbio)
UniProt: Q5VWK5
Structure
PDB: 

Position
1p31.3
AA seq 629 aa AA seqDB search
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggtcactattcaatgggatgcagtaatagccctttacatactcttcagctgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggaaacttcatttttataaaaatggcatcaaagaaagatttcaaatcacaaggatt
aataaaacaacagctcggctttggtataaaaactttctggaaccacatgcttctatgtac
tgcactgctgaatgtcccaaacattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatattcctgatgaagtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggta
catgtgaagagtttagagacagaagaagagcaacagtatctcacctcaagctatattaac
atctccactgattcattacaaggtggcaagaagtacttggtttgggtccaagcagcaaac
gcactaggcatggaagagtcaaaacaactgcaaattcacctggatgatatagtgatacct
tctgcagccgtcatttccagggctgagactataaatgctacagtgcccaagaccataatt
tattgggatagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaaccaaacttggaatgttaaagaatttgacaccaattttacatatgtgcaacagtca
gaattctacttggagccaaacattaagtacgtatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcagccttggagttcactgttttttcataaaacacctgaaacagttccc
caggtcacatcaaaagcattccaacatgacacatggaattctgggctaacagttgcttcc
atctctacagggcaccttacttctgacaacagaggagacattggacttttattgggaatg
atcgtctttgctgttatgttgtcaattctttctttgattgggatatttaacagatcattc
cgaactgggattaaaagaaggatcttattgttaataccaaagtggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaatagtgaacttatgaat
aataattccagtgagcaggtcctatatgttgatcccatgattacagagataaaagaaatc
ttcatcccagaacacaagcctacagactacaagaaggagaatacaggacccctggagaca
agagactacccgcaaaactcgctattcgacaatactacagttgtatatattcctgatctc
aacactggatataaaccccaaatttcaaattttctgcctgagggaagccatctcagcaat
aataatgaaattacttccttaacacttaaaccaccagttgattccttagactcaggaaat
aatcccaggttacaaaagcatcctaattttgctttttctgtttcaagtgtgaattcacta
agcaacacaatatttcttggagaattaagcctcatattaaatcaaggagaatgcagttct
cctgacatacaaaactcagtagaggaggaaaccaccatgcttttggaaaatgattcaccc
agtgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttggggatc
gtgaatgaggagttgccatctattaatacttattttccacaaaatattttggaaagccac
ttcaataggatttcactcttggaaaagtag

DBGET integrated database retrieval system