KEGG   Homo sapiens (human): 1493
Entry
1493              CDS       T01001                                 
Symbol
CTLA4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
Name
(RefSeq) cytotoxic T-lymphocyte associated protein 4
  KO
K06538  cytotoxic T-lymphocyte-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04660  T cell receptor signaling pathway
hsa05320  Autoimmune thyroid disease
hsa05323  Rheumatoid arthritis
Disease
H00080  Systemic lupus erythematosus
H00081  Hashimoto thyroiditis
H00082  Graves disease
H00083  Allograft rejection
H00108  Autoimmune lymphoproliferative syndromes
H00408  Type 1 diabetes mellitus
H01812  Rasmussen encephalitis
H02123  Celiac disease
Drug target
Bavunalimab: D12317
Cadonilimab: D12190
Ipilimumab: D04603<JP/US>
Quavonlimab: D12233
Tremelimumab: D06657
Volrustomig: D12347
Vudalimab: D12186
Zalifrelimab: D11823
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1493 (CTLA4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    1493 (CTLA4)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    1493 (CTLA4)
   05320 Autoimmune thyroid disease
    1493 (CTLA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1493 (CTLA4)
CD molecules [BR:hsa04090]
 Proteins
  1493 (CTLA4)
SSDB
Motif
Pfam: V-set V-set_2 Ig_3 I-set
Other DBs
NCBI-GeneID: 1493
NCBI-ProteinID: NP_005205
OMIM: 123890
HGNC: 2505
Ensembl: ENSG00000163599
Pharos: P16410(Tclin)
UniProt: P16410
Structure
Position
2:203867771..203873965
AA seq 223 aa
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcttgccttggatttcagcggcacaaggctcagctgaacctggctaccaggacctgg
ccctgcactctcctgttttttcttctcttcatccctgtcttctgcaaagcaatgcacgtg
gcccagcctgctgtggtactggccagcagccgaggcatcgccagctttgtgtgtgagtat
gcatctccaggcaaagccactgaggtccgggtgacagtgcttcggcaggctgacagccag
gtgactgaagtctgtgcggcaacctacatgatggggaatgagttgaccttcctagatgat
tccatctgcacgggcacctccagtggaaatcaagtgaacctcactatccaaggactgagg
gccatggacacgggactctacatctgcaaggtggagctcatgtacccaccgccatactac
ctgggcataggcaacggaacccagatttatgtaattgatccagaaccgtgcccagattct
gacttcctcctctggatccttgcagcagttagttcggggttgtttttttatagctttctc
ctcacagctgtttctttgagcaaaatgctaaagaaaagaagccctcttacaacaggggtc
tatgtgaaaatgcccccaacagagccagaatgtgaaaagcaatttcagccttattttatt
cccatcaattga

DBGET integrated database retrieval system