KEGG   Homo sapiens (human): 1493Help
Entry
1493              CDS       T01001                                 

Gene name
CTLA4, ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12
Definition
(RefSeq) cytotoxic T-lymphocyte associated protein 4
  KO
K06538  cytotoxic T-lymphocyte-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04660  T cell receptor signaling pathway
hsa05320  Autoimmune thyroid disease
hsa05323  Rheumatoid arthritis
Disease
H00081  Hashimoto thyroiditis
H00082  Graves disease
H00083  Allograft rejection
H00108  Autoimmune lymphoproliferative syndromes
H00408  Type 1 diabetes mellitus
H01812  Rasmussen encephalitis
H02123  Celiac disease
Drug target
Ipilimumab: D04603
Tremelimumab: D06657
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1493 (CTLA4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    1493 (CTLA4)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    1493 (CTLA4)
   05320 Autoimmune thyroid disease
    1493 (CTLA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1493 (CTLA4)
CD molecules [BR:hsa04090]
 Proteins
  1493 (CTLA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set V-set_2 Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 1493
NCBI-ProteinID: NP_005205
OMIM: 123890
HGNC: 2505
Ensembl: ENSG00000163599
Vega: OTTHUMG00000132877
Pharos: P16410(Tclin)
UniProt: P16410
Structure
PDB: 

Position
2q33.2
AA seq 223 aa AA seqDB search
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttggatttcagcggcacaaggctcagctgaacctggctaccaggacctgg
ccctgcactctcctgttttttcttctcttcatccctgtcttctgcaaagcaatgcacgtg
gcccagcctgctgtggtactggccagcagccgaggcatcgccagctttgtgtgtgagtat
gcatctccaggcaaagccactgaggtccgggtgacagtgcttcggcaggctgacagccag
gtgactgaagtctgtgcggcaacctacatgatggggaatgagttgaccttcctagatgat
tccatctgcacgggcacctccagtggaaatcaagtgaacctcactatccaaggactgagg
gccatggacacgggactctacatctgcaaggtggagctcatgtacccaccgccatactac
ctgggcataggcaacggaacccagatttatgtaattgatccagaaccgtgcccagattct
gacttcctcctctggatccttgcagcagttagttcggggttgtttttttatagctttctc
ctcacagctgtttctttgagcaaaatgctaaagaaaagaagccctcttacaacaggggtc
tatgtgaaaatgcccccaacagagccagaatgtgaaaagcaatttcagccttattttatt
cccatcaattga

DBGET integrated database retrieval system