KEGG   Homo sapiens (human): 149345Help
Entry
149345            CDS       T01001                                 

Gene name
SHISA4, C1orf40, TMEM58
Definition
(RefSeq) shisa family member 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Shisa AbrB EphA2_TM DUF4193
Motif
Other DBs
NCBI-GeneID: 149345
NCBI-ProteinID: NP_937792
OMIM: 617326
HGNC: 27139
Ensembl: ENSG00000198892
Vega: OTTHUMG00000035807
Pharos: Q96DD7(Tdark)
UniProt: Q96DD7
Position
1q32.1
AA seq 197 aa AA seqDB search
MPPAGLRRAAPLTAIALLVLGAPLVLAGEDCLWYLDRNGSWHPGFNCEFFTFCCGTCYHR
YCCRDLTLLITERQQKHCLAFSPKTIAGIASAVILFVAVVATTICCFLCSCCYLYRRRQQ
LQSPFEGQEIPMTGIPVQPVYPYPQDPKAGPAPPQPGFIYPPSGPAPQYPLYPAGPPVYN
PAAPPPYMPPQPSYPGA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgcggggctccgccgggccgcgccgctcaccgcaatcgctctgttggtgctg
ggggctcccctggtgctggccggcgaggactgcctgtggtacctggaccggaatggctcc
tggcatccggggtttaactgcgagttcttcaccttctgctgcgggacctgctaccatcgg
tactgctgcagggacctgaccttgcttatcaccgagaggcagcagaagcactgcctggcc
ttcagccccaagaccatagcaggcatcgcctcagctgtgatcctctttgttgctgtggtt
gccaccaccatctgctgcttcctctgttcctgttgctacctgtaccgccggcgccagcag
ctccagagcccatttgaaggccaggagattccaatgacaggcatcccagtgcagccagta
tacccatacccccaggaccccaaagctggccctgcacccccacagcctggcttcatatac
ccacctagtggtcctgctccccaatatccactctacccagctgggcccccagtctacaac
cctgcagctcctcctccctatatgccaccacagccctcttacccgggagcctga

DBGET integrated database retrieval system