KEGG   Homo sapiens (human): 149371Help
Entry
149371            CDS       T01001                                 

Gene name
EXOC8, EXO84, Exo84p, SEC84
Definition
(RefSeq) exocyst complex component 8
  KO
K19986  exocyst complex component 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    149371 (EXOC8)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    149371 (EXOC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo84_C Vps51 Dor1 PH COG2
Motif
Other DBs
NCBI-GeneID: 149371
NCBI-ProteinID: NP_787072
OMIM: 615283
HGNC: 24659
Ensembl: ENSG00000116903
Vega: OTTHUMG00000038025
Pharos: Q8IYI6(Tbio)
UniProt: Q8IYI6
Position
1q42.2
AA seq 725 aa AA seqDB search
MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLK
RNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAGAAAASGG
EEGVGGAGGRDHLRGQAGFFSTPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPG
QYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYSLDGLAVVN
VKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEDTKRALSEKRRREQEEAAAPRG
PPQVTSKATNPFEDDEEEEPAVPEVEEEKVDLSMEWIQELPEDLDVCIAQRDFEGAVDLL
DKLNHYLEDKPSPPPVKELRAKVEERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIR
LGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFEIDFAG
TDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLT
FIIHALLVKDIQGALHSYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSN
FEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDY
SLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPES
TTSVV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgatgtcggacagtggggcgagccgcctgcgtcggcagctggagtcaggg
ggttttgaggcgcggctgtacgtgaagcagctctcgcagcagtcggatggggaccgggac
ctccaggagcaccggcagcgcatccaggcgctggcggaggagacggcgcagaacctgaag
cgcaacgtctaccagaactaccggcagttcatagagacggcccgcgagatctcctacctg
gagagcgagatgtaccagctcagccatttgctgaccgagcagaaaagcagcctggagagc
atcccgcttacgttgctgcctgccgctgctgccgccggagccgccgccgcctctggaggg
gaggagggagtcggtggggcggggggccgagaccacctccgaggccaggccggctttttc
tccacccccgggggtgcctcccgcgacggctccggtccaggcgaggaaggaaagcagcgc
actctcaccaccctgcttgagaaggtggaaggctgcaggcatctgctggagacgccggga
cagtacttggtgtacaatggggacctagtggaatacgatgcggaccacatggcccaactg
cagcgggtgcacggctttctcatgaacgattgcttgttggtggctacctggctgcctcag
cggcgtgggatgtatcgctacaacgctctctattccctagatggtttggccgtagtcaat
gtcaaggacaacccgcccatgaaggacatgttcaagctgcttatgttccccgagagccgt
attttccaggccgaaaatgctaaaatcaaacgagagtggctggaagtgctggaggacacc
aagagggccctcagtgagaaaaggcgaagggagcaggaggaggcagcggcccctcgaggg
ccaccccaagtgacttccaaggccactaacccatttgaggatgacgaagaagaagaacca
gctgttcctgaggtagaggaagagaaggtggacctctccatggaatggatccaggagtta
cctgaagacctggatgtctgcattgcgcagagagactttgaaggggcggttgacctgctg
gataaattgaaccattacctggaagataaacctagcccacctcctgtaaaagaactaagg
gccaaagtggaggagcgagttcgacagctcactgaggtgctagttttcgaactctcccca
gatcgttccctgagaggtggtccgaaggctactcgcagagcagtttcgcaactgatccgg
ctgggccagtgcacgaaggcctgtgagctatttttgagaaacagggcagccgctgttcat
actgcaattcgtcagcttcgcatcgaaggtgccactttactctatattcataagctgtgc
catgtcttctttaccagccttctcgagactgcaagagaatttgagatcgattttgcaggc
actgacagcggctgctactctgcctttgtggtctgggcaagatcagccatgggcatgttc
gtggatgcttttagcaagcaggtgtttgatagtaaggagagcctctctacagcagctgag
tgtgtaaaagtggctaaggagcattgccagcaactgggtgatatcggactggatctcacc
ttcatcatccatgcccttctggtgaaagacatccaaggggccttgcacagttacaaagaa
atcatcattgaagccactaaacatcgcaactctgaagagatgtggaggaggatgaacttg
atgacgccagaagccctgggtaagctcaaagaagagatgaaaagttgtggggtaagtaac
tttgagcagtacacaggggatgactgctgggtgaacctaagttacacagtggttgctttc
accaaacagaccatgggcttcttggaagaggccctgaagctgtatttcccagagctgcac
atggtacttttggagagcctggtggaaatcattttggttgctgttcagcatgtggattat
agtcttcgatgtgagcaggatccagagaagaaagcttttatcagacagaatgcatccttt
ttatatgaaacagtcctccctgtggtggagaaaaggtttgaagaaggtgtggggaaacct
gccaagcaactccaagatctgaggaatgcatctagacttattcgtgtgaatcctgaaagt
acaacatcagtggtctaa

DBGET integrated database retrieval system