KEGG   Homo sapiens (human): 149420Help
Entry
149420            CDS       T01001                                 

Gene name
PDIK1L, CLIK1L, STK35L2
Definition
(RefSeq) PDLIM1 interacting kinase 1 like
  KO
K17539  serine/threonine-protein kinase PDIK1L [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    149420 (PDIK1L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     149420 (PDIK1L)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NKF4 family
   149420 (PDIK1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 149420
NCBI-ProteinID: NP_001230461
OMIM: 610785
HGNC: 18981
Ensembl: ENSG00000175087
Vega: OTTHUMG00000007511
Pharos: Q8N165(Tdark)
UniProt: Q8N165
Position
1p36.11
AA seq 341 aa AA seqDB search
MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSI
KSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVETSLKGEIAFDPRSAYYLWFVMD
FCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLHKNQIIHRDLKPDNILISQTRLDTS
DLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPEVWEGHYTAKADI
FALGIIIWAMLERITFIDTETKKELLGSYVKQGTEIVPVGEALLENPKMELLIPVKKKSM
NGRMKQLIKEMLAANPQDRPDAFELELRLVQIAFKDSSWET
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtagccagccaaagtacgatctaatacgggaggtaggccgaggtagttacggt
gttgtgtatgaagcagtcatcagaaagacctctgcacgggtggcagtgaagaaaattcga
tgtcacgcacctgaaaatgttgaactagcccttcgtgagttctgggcactaagcagtatc
aagagccaacatccaaatgtgattcacttggaggaatgcatcctacaaaaggatgggatg
gtgcaaaagatgtcccacggctctaattcttccctttatttacagcttgtagaaacttca
ttaaaaggagaaattgcctttgatcccagaagcgcctattatttgtggtttgtgatggat
ttttgtgacggaggagatatgaatgagtatctgttgtccaggaaacccaatcgtaaaact
aacaccagcttcatgcttcagctgagcagtgccctggctttcttgcataaaaaccagatc
atccaccgagatcttaagcctgataacatcctgatttctcaaaccaggttggataccagt
gacttggaacctaccctcaaagtggctgattttggtctaagtaaagtttgttcagcctct
gggcagaacccagaagaacctgtcagtgtaaacaagtgtttcctttccacagcatgtgga
acagatttttacatggctcctgaagtttgggaaggacattacacagcaaaagctgacatc
tttgctctggggattatcatctgggcaatgctggaaaggatcacattcatagacacagag
acaaagaaggaactcttggggagttatgtaaaacaaggaactgagattgtgcctgttggg
gaggcacttctggaaaatcccaaaatggaacttctcattcctgtgaagaaaaaatctatg
aatgggcgaatgaaacaactgattaaggaaatgctggctgcaaaccctcaggatcgtcca
gatgcttttgaactagaactcagattagtacaaattgcatttaaagatagcagctgggaa
acgtga

DBGET integrated database retrieval system