KEGG   Homo sapiens (human): 1495Help
Entry
1495              CDS       T01001                                 

Gene name
CTNNA1, CAP102, MDPT2
Definition
(RefSeq) catenin alpha 1
  KO
K05691  catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04670  Leukocyte transendothelial migration
hsa05100  Bacterial invasion of epithelial cells
hsa05200  Pathways in cancer
hsa05213  Endometrial cancer
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H01890  Pattern dystrophies of the retinal pigment epithelium
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    1495 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    1495 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1495 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1495 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    1495 (CTNNA1)
   05213 Endometrial cancer
    1495 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1495 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1495 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1495 (CTNNA1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     1495 (CTNNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin Peptidase_C5 I_LWEQ
Motif
Other DBs
NCBI-GeneID: 1495
NCBI-ProteinID: NP_001310911
OMIM: 116805
HGNC: 2509
Ensembl: ENSG00000044115
Vega: OTTHUMG00000163502
Pharos: P35221(Tbio)
UniProt: P35221 A0A384MDY0
Structure
PDB: 

Position
5q31.2
AA seq 906 aa AA seqDB search
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtccatgcaggcaacataaacttcaagtgggatcctaaaagtctagagatc
aggactctggcagttgagagactgttggagcctcttgttacacaggttacaacccttgta
aacaccaatagtaaagggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggagaagggggataaaattgcg
aaggagagccagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaaggctgctgcaggagagttcgcagatgatccctgctcttctgtgaag
cgaggcaacatggttcgggcagctcgagctttgctctctgctgttacccggttgctgatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atcttgaagttgaggaatgctggcaatgaacaagacttaggaatccagtataaagcccta
aaacctgaagtggataagctgaacattatggcagccaaaagacaacaggaattgaaagat
gttggccatcgtgatcagatggctgcagctagaggaatcctgcagaagaacgttccgatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agggacctgatatacaagcagctgcagcaggcggtcacaggcatttccaatgcagcccag
gccactgcctcagacgatgcctcacagcaccagggtggaggaggaggagaactggcatat
gcactcaataactttgacaaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccttccctggaggagcgtctggaaagcatcattagtggggctgccttgatggcc
gactcgtcctgcacgcgtgatgaccgtcgtgagcgaattgtggcagagtgtaatgctgtc
cgccaggccctgcaggacctgctttcggagtacatgggcaatgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtaga
cagctccgcaaagctgtcatggaccacgtttcagattctttcctggaaaccaatgttcca
cttttggtattgattgaagctgcaaagaatggaaatgagaaagaagttaaggagtatgcc
caagttttccgtgaacatgccaacaaattgattgaggttgccaacttggcctgttccatc
tcaaataatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagttagaagccctc
tgtcctcaggttattaatgctgcactggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacaatgggaaaaacaagtccgtgttctcacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagatgtgaacaaatgtgtcattgctctccaagagaaggatgtggatggcctggaccgc
acagctggtgcaattcgaggccgggcagcccgggtcattcacgtagtcacctcagagatg
gacaactatgagccaggagtctacacagagaaggttctggaagccactaagctgctctcc
aacacagtcatgccacgttttactgagcaagtagaagcagccgtggaagccctcagctcg
gaccctgcccagcccatggatgagaatgagtttatcgatgcttcccgcctggtatatgat
ggcatccgggacatcaggaaagcagtgctgatgataaggacccctgaggagttggatgac
tctgactttgagacagaagattttgatgtcagaagcaggacgagcgtccagacagaagac
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcgaagattgcggaacaggtggccagcttccaggaagaaaagagcaagctggatgct
gaagtgtccaaatgggacgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgattatgatggagatgacagactttacccgaggtaaaggaccactcaaaaatacatcg
gatgtcatcagtgctgccaagaaaattgctgaggcaggatccaggatggacaagcttggc
cgcaccattgcagaccattgccccgactcggcttgcaagcaggacctgctggcctacctg
caacgcatcgccctctactgccaccagctgaacatctgcagcaaggtcaaggccgaggtg
cagaatctcggcggggagcttgttgtctctggggtggacagcgccatgtccctgatccag
gcagccaagaacttgatgaatgctgtggtgcagacagtgaaggcatcctacgtcgcctct
accaaataccaaaagtcacagggtatggcttccctcaaccttcctgctgtgtcatggaag
atgaaggcaccagagaaaaagccattggtgaagagagagaaacaggatgagacacagacc
aagattaaacgggcatctcagaagaagcacgtgaacccggtgcaggccctcagcgagttc
aaagctatggacagcatctaa

KEGG   Homo sapiens (human): 1496Help
Entry
1496              CDS       T01001                                 

Gene name
CTNNA2, CAP-R, CAPR, CDCBM9, CT114, CTNR
Definition
(RefSeq) catenin alpha 2
  KO
K05691  catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04670  Leukocyte transendothelial migration
hsa05100  Bacterial invasion of epithelial cells
hsa05200  Pathways in cancer
hsa05213  Endometrial cancer
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H01881  Complex cortical dysplasia with other brain malformations
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    1496 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    1496 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1496 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1496 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    1496 (CTNNA2)
   05213 Endometrial cancer
    1496 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1496 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1496 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1496 (CTNNA2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     1496 (CTNNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin CorA
Motif
Other DBs
NCBI-GeneID: 1496
NCBI-ProteinID: NP_001269526
OMIM: 114025
HGNC: 2510
Ensembl: ENSG00000066032
Vega: OTTHUMG00000152903
Pharos: P26232(Tbio)
UniProt: P26232
Structure
PDB: 

Position
2p12
AA seq 953 aa AA seqDB search
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggcaacttcacctatcattctgaaatgggaccccaaaagtttggaaatccgg
acgctaacagtggaaaggctgttggagccacttgttacacaggtgactacacttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtacta
gctgcctctgtagagcaagccactcagaatttcctggaaaagggtgaacagatcgctaag
gagagtcaagatctcaaagaagagttggtggctgctgtagaggatgtgcgcaaacaaggt
gagacgatgcggatcgcctcctccgagtttgcagatgacccttgctcgtcggtaaagcgc
ggcaccatggtacgggcggcaagggctttgctctccgcggtgacacgcttactcatcctg
gcggacatggcagatgtcatgagacttttatcccatctgaaaattgtggaagaggccctg
gaagctgtcaaaaatgctacaaatgagcaagaccttgcaaaccgttttaaagagtttggg
aaagagatggtgaaacttaactatgtagcagcaagaagacaacaggagctgaaggatcct
cactgtcgggatgagatggcagccgcccgaggggctctgaagaagaatgccacaatgctg
tacacggcctctcaagcatttctccgccacccagatgtcgccgctacgagagccaaccga
gattatgtgttcaaacaagtccaggaggccatcgccggcatctccaatgctgctcaagct
acctcgcccactgacgaagccaagggccacacgggcatcggcgagctggctgcggctctt
aatgagtttgacaataagattatcctggaccccatgacgttcagcgaggccaggttccgg
ccgtccctggaggagaggctggagagcatcatcagcggcgcagcgctgatggccgactcc
tcctgcacgcgagacgaccggcgcgagaggatcgtggcggagtgcaacgccgtgcggcag
gcgctccaggacctgctcagcgagtacatgaataatactggaaggaaagaaaaaggagat
cctctcaacattgcgattgataagatgactaagaaaacaagagatctaaggagacagctt
cggaaagcagtgatggatcacatatctgactctttcctggaaaccaatgttcctttgcta
gttctcattgaggctgcaaagagcggaaatgaaaaggaagtgaaagaatatgcccaagtt
ttccgtgagcatgccaacaaactggtagaggttgccaatttggcctgttccatctccaac
aatgaagaaggggtgaaattagttcggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgccgctctgacactggctgcccggccacagagcaaagttgctcaggat
aacatggacgtcttcaaagaccagtgggagaagcaggtccgagtgttgacagaggccgtg
gatgacatcacctcagtggatgacttcctctctgtctcagaaaatcacatcttggaggat
gtgaacaagtgtgtgatagccctccaagagggcgatgtggacactctggaccggactgca
ggggccatcaggggccgggcagctcgagtcatacacatcatcaatgctgagatggagaac
tatgaagctggggtttatactgagaaggtgttggaagctacaaaattgctttctgaaaca
gtgatgccacgcttcgctgaacaagtagaggttgccattgaagccctgagtgccaacgtt
cctcaaccgtttgaggagaatgagttcatcgatgcctctcgcctggtgtatgatggcgtt
cgggacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaggatgattct
gactttgagcaggaagattatgatgtgcgtagcaggacaagtgttcagactgaggatgac
cagctcattgcagggcagagcgcacgggccatcatggcgcaactaccgcaggaggagaag
gcaaaaatagctgagcaggtggagatattccatcaagagaaaagcaagctggatgcagaa
gtggccaaatgggacgacagcggcaatgatatcattgtactggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgat
gtcattaatgctgccaagaaaattgccgaagcaggttctcgaatggacaaattagctcgt
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcagaagtgcag
aatctgggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccgatcgggagtggaagcagtgattcctccatgctggac
agtgccacatcgcttatccaggcagctaaaaacctgatgaatgctgttgtcctcacggtg
aaagcatcctatgtggcctcaaccaaataccagaaggtctatgggacagcagctgtcaac
tcacctgttgtgtcttggaagatgaaggctccagagaagaagccccttgtgaagagagaa
aagcctgaagaattccagacacgagttcgacgaggttctcagaagaaacacatttcgcct
gtacaggctttaagtgaattcaaagcaatggattccttctag

KEGG   Homo sapiens (human): 29119Help
Entry
29119             CDS       T01001                                 

Gene name
CTNNA3, ARVD13, VR22
Definition
(RefSeq) catenin alpha 3
  KO
K05691  catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04670  Leukocyte transendothelial migration
hsa05100  Bacterial invasion of epithelial cells
hsa05200  Pathways in cancer
hsa05213  Endometrial cancer
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    29119 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    29119 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    29119 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29119 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    29119 (CTNNA3)
   05213 Endometrial cancer
    29119 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    29119 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    29119 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    29119 (CTNNA3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     29119 (CTNNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin
Motif
Other DBs
NCBI-GeneID: 29119
NCBI-ProteinID: NP_001120856
OMIM: 607667
HGNC: 2511
Ensembl: ENSG00000183230
Vega: OTTHUMG00000018334
Pharos: Q9UI47(Tbio)
UniProt: Q9UI47 A8K141 Q8WW10
Position
10q21.3
AA seq 895 aa AA seqDB search
MSAETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLA
SVEEATWNLLDKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDELENLIVLNPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN
IALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQAVKNTME
MYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSLNV
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgaaacaccaatcacattgaatatcgatcctcaggatctgcaggtccaaaca
ttcaccgtggagaagctactggagcctctcataatccaggttaccacacttgtaaactgt
ccccagaacccttccagcaggaaaaaaggacgttcgaaaagagccagtgtccttctagct
tctgtggaggaagcaacttggaatttattagacaagggagagaagattgcccaggaagct
acagttttaaaggatgagcttacggcttcacttgaggaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgagagatttacagatgacccctgttttctcccaaaaagggaggct
gtggttcaagctgcccgtgccttgctggctgcggtgacgagactccttatccttgcggac
atgattgatgtcatgtgcctcttgcaacatgtgtcagcttttcaaaggacatttgagtct
ctcaaaaatgttgccaacaaatctgacctccagaaaacctaccagaagcttgggaaggag
ctggaaaatttggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcag
agagatgaaattgcaggagcccgagcttcactgaaggagaactctcccctcttgcattca
atttgttcagcttgtttggagcattctgatgttgcttccctcaaagcaagcaaggacaca
gtttgtgaagaaattcagaatgctctcaatgtaatttcaaatgcttcacaagggatccag
aatatgacaaccccaccagaacctcaggcagcaaccctgggaagtgcccttgatgagctg
gagaatttaattgtcctgaatccactcacagtaactgaggaggaaatacgaccatcacta
gagaaacgccttgaagccattatcagtggggctgctctgctggcggattcttcatgtacg
agggacttacaccgagagcggattatcgcagaatgcaacgccattcgccaggctcttcag
gatctgctttcagagtacatgaacaacgctggaaaaaaagaaaggagtaataccctgaat
attgctttagacaacatgtgtaagaagacaagagaccttcgcagacagctccgcaaggct
attatagatcatgtgtcagactctttcctggatacgacagtccctcttttggttctcatt
gaagctgctaagaatggccgggaaaaggaaataaaagaatatgctgcgatatttcatgaa
cacaccagcaggcttgtagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaattgtcaaaattgcagccaatcatttggaaaccttgtgtccacagattatt
aatgctgcacttgctttggctgcaagacccaaaagtcaagcggtcaaaaacaccatggaa
atgtacaagcgtacatgggagaatcatatacatgtcctcactgaagccgtagatgacatt
acaagcattgatgacttccttgctgtatctgaaagccatatcttggaagatgtcaacaag
tgtatcatagccttaagagaccaggatgctgataatttagaccgtgctgcgggtgctatc
agaggccgggcagcaagagttgctcacatcgtcacgggtgaaatggacagttacgagcca
ggggcttacacggaaggtgtaatgagaaatgttaacttccttacaagtactgtaattcct
gaatttgtaacacaagtgaatgttgccttggaagccttaagcaaaagctcattgaatgtg
ttggatgataatcaatttgtggacatctcaaagaagatctatgatacaattcatgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaggatgtttctgaccttgaa
gaggaacacgaggtccgcagtcacaccagcattcagaccgaagggaaaactgatagggct
aagatgactcaactgcctgaggcagaaaaagaaaagattgctgagcaagttgctgatttc
aagaaagtaaagagtaagctggatgctgagattgagatatgggatgatacaagcaacgac
atcattgttctggccaagaacatgtgtatgatcatgatggagatgacagacttcactagg
ggcaaaggaccactaaagcatacaactgatgtgatctatgcagcgaaaatgatatcagaa
tcaggatcaaggatggatgtccttgctcggcagattgctaatcagtgcccagatccatct
tgtaaacaggacttgttggcctacctggaacagattaagttctactcccaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacctgggaggagagctcatcatgtcagct
ttggacagtgtcacatccctgatccaagcagccaaaaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcttacattgcctcaaccaagatcatccgaatccagagtcctgctggg
ccccggcacccagttgtgatgtggagaatgaaggctcctgcaaaaaaacccttgattaaa
agagagaagccagaggaaacgtgtgcagctgtcagacgaggctcagcaaagaaaaaaatc
catccattgcaagtcatgagtgaatttagaggaagacaaatctactga

DBGET integrated database retrieval system