KEGG   Homo sapiens (human): 1496Help
Entry
1496              CDS       T01001                                 

Gene name
CTNNA2, CAP-R, CAPR, CT114, CTNR
Definition
(RefSeq) catenin alpha 2
  KO
K05691  catenin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04670  Leukocyte transendothelial migration
hsa05100  Bacterial invasion of epithelial cells
hsa05200  Pathways in cancer
hsa05213  Endometrial cancer
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    1496 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    1496 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1496 (CTNNA2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    1496 (CTNNA2)
   05226 Gastric cancer
    1496 (CTNNA2)
   05213 Endometrial cancer
    1496 (CTNNA2)
  09165 Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    1496 (CTNNA2)
  09167 Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1496 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1496 (CTNNA2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     1496 (CTNNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin CorA
Motif
Other DBs
NCBI-GeneID: 1496
NCBI-ProteinID: NP_001269526
OMIM: 114025
HGNC: 2510
Ensembl: ENSG00000066032
Vega: OTTHUMG00000152903
Pharos: P26232(Tbio)
UniProt: P26232
Position
2p12
AA seq 953 aa AA seqDB search
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggcaacttcacctatcattctgaaatgggaccccaaaagtttggaaatccgg
acgctaacagtggaaaggctgttggagccacttgttacacaggtgactacacttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtacta
gctgcctctgtagagcaagccactcagaatttcctggaaaagggtgaacagatcgctaag
gagagtcaagatctcaaagaagagttggtggctgctgtagaggatgtgcgcaaacaaggt
gagacgatgcggatcgcctcctccgagtttgcagatgacccttgctcgtcggtaaagcgc
ggcaccatggtacgggcggcaagggctttgctctccgcggtgacacgcttactcatcctg
gcggacatggcagatgtcatgagacttttatcccatctgaaaattgtggaagaggccctg
gaagctgtcaaaaatgctacaaatgagcaagaccttgcaaaccgttttaaagagtttggg
aaagagatggtgaaacttaactatgtagcagcaagaagacaacaggagctgaaggatcct
cactgtcgggatgagatggcagccgcccgaggggctctgaagaagaatgccacaatgctg
tacacggcctctcaagcatttctccgccacccagatgtcgccgctacgagagccaaccga
gattatgtgttcaaacaagtccaggaggccatcgccggcatctccaatgctgctcaagct
acctcgcccactgacgaagccaagggccacacgggcatcggcgagctggctgcggctctt
aatgagtttgacaataagattatcctggaccccatgacgttcagcgaggccaggttccgg
ccgtccctggaggagaggctggagagcatcatcagcggcgcagcgctgatggccgactcc
tcctgcacgcgagacgaccggcgcgagaggatcgtggcggagtgcaacgccgtgcggcag
gcgctccaggacctgctcagcgagtacatgaataatactggaaggaaagaaaaaggagat
cctctcaacattgcgattgataagatgactaagaaaacaagagatctaaggagacagctt
cggaaagcagtgatggatcacatatctgactctttcctggaaaccaatgttcctttgcta
gttctcattgaggctgcaaagagcggaaatgaaaaggaagtgaaagaatatgcccaagtt
ttccgtgagcatgccaacaaactggtagaggttgccaatttggcctgttccatctccaac
aatgaagaaggggtgaaattagttcggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgccgctctgacactggctgcccggccacagagcaaagttgctcaggat
aacatggacgtcttcaaagaccagtgggagaagcaggtccgagtgttgacagaggccgtg
gatgacatcacctcagtggatgacttcctctctgtctcagaaaatcacatcttggaggat
gtgaacaagtgtgtgatagccctccaagagggcgatgtggacactctggaccggactgca
ggggccatcaggggccgggcagctcgagtcatacacatcatcaatgctgagatggagaac
tatgaagctggggtttatactgagaaggtgttggaagctacaaaattgctttctgaaaca
gtgatgccacgcttcgctgaacaagtagaggttgccattgaagccctgagtgccaacgtt
cctcaaccgtttgaggagaatgagttcatcgatgcctctcgcctggtgtatgatggcgtt
cgggacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaggatgattct
gactttgagcaggaagattatgatgtgcgtagcaggacaagtgttcagactgaggatgac
cagctcattgcagggcagagcgcacgggccatcatggcgcaactaccgcaggaggagaag
gcaaaaatagctgagcaggtggagatattccatcaagagaaaagcaagctggatgcagaa
gtggccaaatgggacgacagcggcaatgatatcattgtactggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgat
gtcattaatgctgccaagaaaattgccgaagcaggttctcgaatggacaaattagctcgt
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcagaagtgcag
aatctgggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccgatcgggagtggaagcagtgattcctccatgctggac
agtgccacatcgcttatccaggcagctaaaaacctgatgaatgctgttgtcctcacggtg
aaagcatcctatgtggcctcaaccaaataccagaaggtctatgggacagcagctgtcaac
tcacctgttgtgtcttggaagatgaaggctccagagaagaagccccttgtgaagagagaa
aagcctgaagaattccagacacgagttcgacgaggttctcagaagaaacacatttcgcct
gtacaggctttaagtgaattcaaagcaatggattccttctag

DBGET integrated database retrieval system