KEGG   Homo sapiens (human): 149603
Entry
149603            CDS       T01001                                 

Gene name
RNF187, RACO-1, RACO1
Definition
(RefSeq) ring finger protein 187
  KO
K15709  E3 ubiquitin-protein ligase RNF187 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    149603 (RNF187)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     149603 (RNF187)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    149603 (RNF187)
SSDB
Motif
Pfam: zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4_3 zf-RING_2 zf-C3HC4_5 zf-Nse zf-RING_5 zf-rbx1 zf-B_box
Other DBs
NCBI-GeneID: 149603
NCBI-ProteinID: NP_001010858
OMIM: 613754
HGNC: 27146
Ensembl: ENSG00000168159
Vega: OTTHUMG00000040043
Pharos: Q5TA31(Tbio)
UniProt: Q5TA31
Position
1q42.13
AA seq 235 aa
MALPAGPAEAACALCQRAPREPVRADCGHRFCRACVVRFWAEEDGPFPCPECADDCWQRA
VEPGRPPLSRRLLALEEAAAAPARDGPASEAALQLLCRADAGPLCAACRMAAGPEPPEWE
PRWRKALRGKENKGSVEIMRKDLNDARDLHGQAESAAAVWKGHVMDRRKKALTDYKKLRA
FFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ
NT seq 708 nt   +upstreamnt  +downstreamnt
ctggcgctccctgcgggccccgccgaggccgcctgcgccctgtgccagcgcgcgccccgg
gaaccggtgcgcgccgactgcggccaccgcttctgtcgggcgtgcgtggtgcgcttctgg
gccgaggaggacgggcccttcccgtgccccgagtgcgccgacgactgctggcagcgcgcc
gtggagcccggcaggcccccgctcagccgccgccttctggcgctcgaggaggcggccgcg
gcgcccgcgcgcgacggcccggccagcgaggccgcgctgcagctgctgtgccgcgccgac
gccggcccgctctgcgccgcctgccgtatggctgcgggccccgagccgcccgagtgggaa
ccgcgctggaggaaggcgctgcgcggcaaggagaacaaggggtctgtggaaatcatgaga
aaggacttgaatgacgcccgggacctgcatggccaggcagagtcagcagctgcagtgtgg
aagggacacgtgatggaccgtaggaagaaggcactgaccgactacaagaagctgcgggcc
ttctttgtggaggaggaggagcatttcctgcaggaggctgagaaggaggaggggctccct
gaggacgagctggctgaccccactgagcggttcaggtcactgctgcaggcggtctcggag
ctggagaagaagcatcgcaacctgggcctcagcatgctgctgcagtga

DBGET integrated database retrieval system