KEGG   Homo sapiens (human): 149628Help
Entry
149628            CDS       T01001                                 

Gene name
PYHIN1, IFIX
Definition
(RefSeq) pyrin and HIN domain family member 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HIN PYRIN
Motif
Other DBs
NCBI-GeneID: 149628
NCBI-ProteinID: NP_689714
OMIM: 612677
HGNC: 28894
Ensembl: ENSG00000163564
Vega: OTTHUMG00000037109
Pharos: Q6K0P9(Tbio)
UniProt: Q6K0P9
Position
1q23.1
AA seq 492 aa AA seqDB search
MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDA
GLGKLIEFFKEIPTLGDLAETLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACT
PSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQ
TSSSAPPNTSSTESLKPLANRHATASKNIFREDPIIAMVLNATKVFKYESSENEQRRMFH
ATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSLLEVNEASSVSEAGPDQTFEV
PKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKTGSMAVVGKGE
CHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQ
HPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLS
SDTSTNRHPAVP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataactacaagaaaattgttctactgaaaggattagaggtcatcaatgattat
cattttagaattgttaagtccttactgagtaacgatttaaaacttaatccaaaaatgaaa
gaagagtatgacaaaattcagattgctgacttgatggaggaaaagttcccaggtgatgcc
ggtttgggcaaactaatagaattcttcaaagaaataccaacactgggagaccttgctgaa
actcttaaaagagaaaagttaaaagttgcaaataaaattgaatccattccagtcaaagga
ataatcccatctaaaaagacgaaacagaaagaagtgtatcctgctacacctgcatgcacc
ccaagcaaccgtctcacagctaaaggagcagaggagactcttggacctcagaaaagaaaa
aaaccatctgaagaagagactggaaccaaaaggagtaagatgtccaaagagcagactcgg
ccttcctgctctgcaggagccagcacgtccacagccatgggccgttccccacctccccag
acctcatcatcagctccacccaacacttcctcaactgagagcctaaaaccattggccaac
cgtcacgcaactgccagtaaaaatattttccgagaagacccaataatcgcgatggtacta
aatgcaacaaaagtatttaaatatgaatcctcagaaaatgagcaaagaagaatgtttcat
gctacagtggctacgcagacacagttctttcatgtgaaggttttaaacatcaacttgaag
aggaaattcattaaaaagagaatcatcattatatcaaattattccaaacgtaatagtctc
ctagaggtgaatgaagcctcttctgtatctgaagctggtcctgaccaaacgtttgaggtt
ccaaaggacatcatcagaagagcaaagaaaattccgaagatcaatattcttcacaaacaa
acttcaggatatattgtatatggattatttatgctacatacgaaaattgtaaataggaag
acgacaatctatgaaattcaggataaaacaggaagtatggctgtagtaggaaaaggagaa
tgccacaatatcccctgtgaaaaaggagataagcttcgactcttctgctttcgactgaga
aagagggaaaatatgtcaaaactgatgtcagaaatgcatagtttcatccagatacagaaa
aatacaaaccagagaagccatgactccaggagcatggcactaccccaggaacagagtcag
catccaaaaccttcagaggccagcacaaccctacctgaaagccatctcaagactcctcag
atgccaccaacaaccccatccagcagttccttcaccaagaaggatgaaacccacccagga
gcacagtcatcgcctgcaaactttagaatcacctcaccaactgtggcccctcctctttct
tctgacacttccaccaaccgccatccagcagttccttaa

DBGET integrated database retrieval system