KEGG   Homo sapiens (human): 149685
Entry
149685            CDS       T01001                                 

Gene name
ADIG, SMAF1
Definition
(RefSeq) adipogenin
  KO
K21409  adipogenin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    149685 (ADIG)
SSDB
Motif
Pfam: Adipogenin
Other DBs
NCBI-GeneID: 149685
NCBI-ProteinID: NP_001018092
OMIM: 611396
HGNC: 28606
Ensembl: ENSG00000182035
Vega: OTTHUMG00000032451
Pharos: Q0VDE8(Tdark)
UniProt: Q0VDE8 A0A158RFT8
Position
20q11.23
AA seq 80 aa
MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKG
PAEFCWKGTLHGQEKERPCW
NT seq 243 nt   +upstreamnt  +downstreamnt
atgaagtaccctttgatgccgctggtgaacgacctcacattttctttcctggttttctgg
ttctgcctccctgtgggtttgctgttgttattgatcatctggctacgcttcttacttagc
caagattcagaggaaaatgactccagtgtgtgcttggattgggagccctggagcaaaggc
ccagctgagttttgctggaaggggacactccacggccaagagaaggagaggccctgctgg
tga

DBGET integrated database retrieval system