KEGG   Homo sapiens (human): 149840
Entry
149840            CDS       T01001                                 
Symbol
SHLD1, C20orf196, RINN3
Name
(RefSeq) shieldin complex subunit 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4521
Other DBs
NCBI-GeneID: 149840
NCBI-ProteinID: NP_001290406
OMIM: 618028
HGNC: 26318
Ensembl: ENSG00000171984
Vega: OTTHUMG00000031813
Pharos: Q8IYI0(Tdark)
UniProt: Q8IYI0
Position
20:5750193..5864395
AA seq 205 aa
MAARDATSGSLSEESSALDLPSACDIRDYVLQGPSQEANSEAFSSLEFHSFPYSSDVDPD
TSNLNIEQNNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSAS
VCKCLSQKITQLRGQESQKYALRSFQMARVIFNRDGCSVLQRHSRDTHFYPLEEGSTSLD
DEKPNPGLSKDITHFLLQQNVMKDL
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcagccagggacgccacttcaggcagcctgtcagaggagagcagtgctttggacctg
ccatcagcgtgtgacataagagattacgtcctgcagggacccagccaagaagccaacagc
gaggctttcagttctttggaattccattcttttccttattcttctgatgtggatccagac
accagtaacttaaatatagaacaaaataactcctggaccgctgagaacttctggcttgac
cctgctgtgaaaggccagtcagagaaggaagaggatgatggccttcggaaatccctggat
agattctatgaaatgtttggtcatccacagccaggctctgcaaactcactctctgcatct
gtctgcaagtgcctgtctcagaaaatcactcaactaagaggccaggagagccaaaagtat
gccctccgcagttttcaaatggcccgggtgatcttcaaccgggacggctgctccgtctta
cagaggcattccagggacacccacttctacccactggaggaaggaagtacatctttggat
gatgaaaagccaaacccaggactgtcaaaggatattactcatttcctcttgcagcagaat
gtaatgaaagacctgtaa

DBGET integrated database retrieval system