KEGG   Homo sapiens (human): 15Help
Entry
15                CDS       T01001                                 

Gene name
AANAT, DSPS, SNAT
Definition
(RefSeq) aralkylamine N-acetyltransferase
  KO
K00669  arylalkylamine N-acetyltransferase [EC:2.3.1.87]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
Module
hsa_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
Disease
H00689  Delayed sleep phase syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    15 (AANAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.87  aralkylamine N-acetyltransferase
     15 (AANAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 15
NCBI-ProteinID: NP_001079
OMIM: 600950
HGNC: 19
Ensembl: ENSG00000129673
Vega: OTTHUMG00000180179
Pharos: Q16613(Tbio)
UniProt: Q16613 F1T0I5
Position
17q25.1
AA seq 207 aa AA seqDB search
MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVL
GVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAH
LHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCA
ITVGSLTFMELHCSLRGHPFLRRNSGC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcagagcacccaccccctgaaacctgaggccccacgtctgccacctgggatc
cccgagtccccgagctgtcagcggcgccacacactccctgccagtgagtttcgctgcctc
accccggaggacgctgtcagcgcctttgagatcgagcgtgaagccttcatctccgtcttg
ggcgtctgccccctgtacctggatgagatccggcacttcctgaccctatgtccagagctg
tccctgggctggttcgaggagggctgccttgtggccttcatcatcggctcgctctgggac
aaggagagactcatgcaggagtcactgacgctgcacaggtctgggggccacatagcccac
ctgcatgtgctggccgtgcaccgcgccttccggcagcagggcaggggccccatcctgctg
tggcgctacctgcaccacctgggcagccagccggccgtgcgccgggccgcgctcatgtgc
gaggacgcgctggtacccttctatgagaggttcagcttccacgccgtgggcccctgcgcc
atcaccgtgggctccctcaccttcatggagctccactgctccctgcggggccaccccttc
ctgcgcaggaacagcggctgctga

DBGET integrated database retrieval system