KEGG   Homo sapiens (human): 150084
Entry
150084            CDS       T01001                                 
Symbol
IGSF5, GSF5, JAM4
Name
(RefSeq) immunoglobulin superfamily member 5
  KO
K06786  junctional adhesion molecule 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    150084 (IGSF5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    150084 (IGSF5)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set
Other DBs
NCBI-GeneID: 150084
NCBI-ProteinID: NP_001073913
OMIM: 610638
HGNC: 5952
Ensembl: ENSG00000183067
Pharos: Q9NSI5(Tbio)
UniProt: Q9NSI5
Position
21:39711771..39802081
AA seq 407 aa
MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNC
TVSQGWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGN
IRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGL
LVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQD
TGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPTCTLTIRCCCCRRRCCGCNCC
CRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTDTASLPPKSCE
SSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgggtcagaaggaaaggagcacagcagatactctgccggatctggaggaatggaagtca
gcggcgggtctgcgatggtggcaaacagcagtggtggacggttctgggtctggtaatgaa
gtcatagaaggcccccaaaatgcaagagtcctgaagggctcccaggctcgcttcaactgc
accgtctcccagggctggaagctcatcatgtgggctctcagtgacatggtggtgctaagc
gtcaggcccatggagcccatcatcaccaatgaccgcttcacctctcagaggtacgaccag
ggcgggaacttcacctcggagatgatcatccacaatgtggagcccagtgattcggggaac
atcagatgcagcctccagaacagtcgcctgcatggatctgcttaccttaccgtccaagtt
atgggagagctgttcattcccagtgttaatcttgtagtcgctgagaatgaaccttgtgaa
gttacttgtctaccctcacactggacccggctcccggatatttcctgggagctcggtctc
ctggtcagccattcaagctattattttgttccggagcccagcgaccttcaaagtgcagtg
agcatcctggctctgaccccacagagcaatgggactttgacttgcgtggctacctggaag
agcctgaaggcccgcaagtctgcaactgtaaatctcactgtgattcggtgtccccaagac
actggaggtggtattaatattccaggtgtattatcaagtttaccgagtttaggtttttca
ttgcctacttggggcaaagttggacttggactagcaggcaccatgcttctgacgccgacg
tgtactcttacaatacgctgctgctgctgccgccgtcgttgttgtggctgcaactgctgc
tgccgttgttgtttctgctgtagaagaaaaagaggatttcgtattcaatttcaaaagaaa
tctgaaaaagagaagacaaacaaagaaactgagacagaaagtggaaatgaaaactccggc
tacaattcagatgaacaaaagaccacagacaccgcttctctccctcccaaatcctgtgaa
tccagtgatcctgaacaaagaaacagtagctgtggccctcctcaccagcgggctgatcaa
cgtccacccaggccagcaagtcatccacaggcttcttttaatctggccagtcctgagaag
gtcagtaatacaactgtagtatag

KEGG   Homo sapiens (human): 50848
Entry
50848             CDS       T01001                                 
Symbol
F11R, CD321, JAM, JAM1, JAMA, JCAM, KAT, PAM-1
Name
(RefSeq) F11 receptor
  KO
K06089  junctional adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    50848 (F11R)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    50848 (F11R)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    50848 (F11R)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    50848 (F11R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    50848 (F11R)
CD molecules [BR:hsa04090]
 Proteins
  50848 (F11R)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set C1-set C2-set_2 DUF5626 Ig_C17orf99 Adeno_E3_CR1 V-set_CD47
Other DBs
NCBI-GeneID: 50848
NCBI-ProteinID: NP_058642
OMIM: 605721
HGNC: 14685
Ensembl: ENSG00000158769
Pharos: Q9Y624(Tbio)
UniProt: Q9Y624 Q6FIB4
Structure
Position
1:complement(160995211..161021152)
AA seq 299 aa
MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
EWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYG
EVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST
RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV
AAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
NT seq 900 nt   +upstreamnt  +downstreamnt
atggggacaaaggcgcaagtcgagaggaaactgttgtgcctcttcatattggcgatcctg
ttgtgctccctggcattgggcagtgttacagtgcactcttctgaacctgaagtcagaatt
cctgagaataatcctgtgaagttgtcctgtgcctactcgggcttttcttctccccgtgtg
gagtggaagtttgaccaaggagacaccaccagactcgtttgctataataacaagatcaca
gcttcctatgaggaccgggtgaccttcttgccaactggtatcaccttcaagtccgtgaca
cgggaagacactgggacatacacttgtatggtctctgaggaaggcggcaacagctatggg
gaggtcaaggtcaagctcatcgtgcttgtgcctccatccaagcctacagttaacatcccc
tcctctgccaccattgggaaccgggcagtgctgacatgctcagaacaagatggttcccca
ccttctgaatacacctggttcaaagatgggatagtgatgcctacgaatcccaaaagcacc
cgtgccttcagcaactcttcctatgtcctgaatcccacaacaggagagctggtctttgat
cccctgtcagcctctgatactggagaatacagctgtgaggcacggaatgggtatgggaca
cccatgacttcaaatgctgtgcgcatggaagctgtggagcggaatgtgggggtcatcgtg
gcagccgtccttgtaaccctgattctcctgggaatcttggtttttggcatctggtttgcc
tatagccgaggccactttgacagaacaaagaaagggacttcgagtaagaaggtgatttac
agccagcctagtgcccgaagtgaaggagaattcaaacagacctcgtcattcctggtgtga

KEGG   Homo sapiens (human): 58494
Entry
58494             CDS       T01001                                 
Symbol
JAM2, C21orf43, CD322, IBGC8, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
Name
(RefSeq) junctional adhesion molecule 2
  KO
K06735  junctional adhesion molecule 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Disease
H01574  Familial idiopathic basal ganglia calcification
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    58494 (JAM2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    58494 (JAM2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    58494 (JAM2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    58494 (JAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    58494 (JAM2)
CD molecules [BR:hsa04090]
 Proteins
  58494 (JAM2)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set C2-set_2 Ig_6 Ig_5 DUF3377
Other DBs
NCBI-GeneID: 58494
NCBI-ProteinID: NP_067042
OMIM: 606870
HGNC: 14686
Ensembl: ENSG00000154721
Pharos: P57087(Tbio)
UniProt: P57087
Position
21:25639258..25717562
AA seq 298 aa
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSR
LEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQN
LEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
LGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGI
IAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcgaggaggagccgccaccgcctcctcctgctgctgctgcgctacctggtggtcgcc
ctgggctatcataaggcctatgggttttctgccccaaaagaccaacaagtagtcacagca
gtagagtaccaagaggctattttagcctgcaaaaccccaaagaagactgtttcctccaga
ttagagtggaagaaactgggtcggagtgtctcctttgtctactatcaacagactcttcaa
ggtgattttaaaaatcgagctgagatgatagatttcaatatccggatcaaaaatgtgaca
agaagtgatgcggggaaatatcgttgtgaagttagtgccccatctgagcaaggccaaaac
ctggaagaggatacagtcactctggaagtattagtggctccagcagttccatcatgtgaa
gtaccctcttctgctctgagtggaactgtggtagagctacgatgtcaagacaaagaaggg
aatccagctcctgaatacacatggtttaaggatggcatccgtttgctagaaaatcccaga
cttggctcccaaagcaccaacagctcatacacaatgaatacaaaaactggaactctgcaa
tttaatactgtttccaaactggacactggagaatattcctgtgaagcccgcaattctgtt
ggatatcgcaggtgtcctgggaaacgaatgcaagtagatgatctcaacataagtggcatc
atagcagccgtagtagttgtggccttagtgatttccgtttgtggccttggtgtatgctat
gctcagaggaaaggctacttttcaaaagaaacctccttccagaagagtaattcttcatct
aaagccacgacaatgagtgaaaatgatttcaagcacacaaaatcctttataatttaa

KEGG   Homo sapiens (human): 83700
Entry
83700             CDS       T01001                                 
Symbol
JAM3, JAM-2, JAM-3, JAM-C, JAMC
Name
(RefSeq) junctional adhesion molecule 3
  KO
K06785  junctional adhesion molecule 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Disease
H01301  Hemorrhagic destruction of the brain, subependymal calcification, and cataracts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    83700 (JAM3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    83700 (JAM3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    83700 (JAM3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    83700 (JAM3)
SSDB
Motif
Pfam: Ig_3 I-set ig V-set Ig_2 Ig_6 C2-set_2 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 83700
NCBI-ProteinID: NP_116190
OMIM: 606871
HGNC: 15532
Ensembl: ENSG00000166086
Pharos: Q9BX67(Tbio)
UniProt: Q9BX67
Position
11:134069072..134152001
AA seq 310 aa
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQT
SDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVAR
NDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPL
PTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDL
NIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEG
DFRHKSSFVI
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcgctgaggcggccaccgcgactccggctctgcgctcggctgcctgacttcttcctg
ctgctgcttttcaggggctgcctgataggggctgtaaatctcaaatccagcaatcgaacc
ccagtggtacaggaatttgaaagtgtggaactgtcttgcatcattacggattcgcagaca
agtgaccccaggatcgagtggaagaaaattcaagatgaacaaaccacatatgtgtttttt
gacaacaaaattcagggagacttggcgggtcgtgcagaaatactggggaagacatccctg
aagatctggaatgtgacacggagagactcagccctttatcgctgtgaggtcgttgctcga
aatgaccgcaaggaaattgatgagattgtgatcgagttaactgtgcaagtgaagccagtg
acccctgtctgtagagtgccgaaggctgtaccagtaggcaagatggcaacactgcactgc
caggagagtgagggccacccccggcctcactacagctggtatcgcaatgatgtaccactg
cccacggattccagagccaatcccagatttcgcaattcttctttccacttaaactctgaa
acaggcactttggtgttcactgctgttcacaaggacgactctgggcagtactactgcatt
gcttccaatgacgcaggctcagccaggtgtgaggagcaggagatggaagtctatgacctg
aacattggcggaattattgggggggttctggttgtccttgctgtactggccctgatcacg
ttgggcatctgctgtgcatacagacgtggctacttcatcaacaataaacaggatggagaa
agttacaagaacccagggaaaccagatggagttaactacatccgcactgacgaggagggc
gacttcagacacaagtcatcgtttgtgatctga

DBGET integrated database retrieval system