KEGG   Homo sapiens (human): 150209
Entry
150209            CDS       T01001                                 

Gene name
AIFM3, AIFL
Definition
(RefSeq) apoptosis inducing factor mitochondria associated 3
  KO
K22747  apoptosis-inducing factor 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    150209 (AIFM3)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Rieske Pyr_redox_3 NAD_binding_8 DAO HI0933_like Reductase_C Rieske_2 FAD_binding_2 FAD_binding_3 TrkA_N Lycopene_cycl Thi4 Shikimate_DH 3HCDH_N UDPG_MGDP_dh_N Trp_halogenase DUF1188 K_oxygenase Cpn60_TCP1 NAD_Gly3P_dh_N
Other DBs
NCBI-GeneID: 150209
NCBI-ProteinID: NP_653305
OMIM: 617298
HGNC: 26398
Ensembl: ENSG00000183773
Vega: OTTHUMG00000150804
Pharos: Q96NN9(Tbio)
UniProt: Q96NN9
Position
22q11.21
AA seq 605 aa
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHP
YPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKV
MAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSK
SLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSS
PKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSV
VELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA
DVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDL
EELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWL
TGKGS
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgggcggctgcttctccaaacccaaaccagtggagctcaagatcgaggtggtgctgcct
gagaaggagcgaggcaaggaggagctgtcggccagtgggaagggcagcccccgggcctac
cagggcaatggcacggcccgccacttccacacggaggagcgcctgtccacccctcacccc
taccccagccctcaggattgcgtggaggctgctgtctgccacgtcaaggacctcgagaat
ggccagatgcgggaagtggagctgggctgggggaaggtgttgctggtgaaggacaatggg
gagttccacgccctgggccataagtgtccgcactacggcgcacccctggtgaaaggcgtt
ctgtcccgtggtcgggtgcgctgcccctggcacggcgcctgcttcaacatcagcactggg
gacctggaggacttccctggcctggacagtctacacaagttccaggtgaagattgagaag
gagaaggtgtacgtccgggccagcaagcaggccctacagctgcagcgaaggaccaaggtg
atggccaagtgtatctctccaagtgctgggtacagcagtagcaccaatgtgctcattgtg
ggtgcaggtgcagctggcctggtgtgtgcagagacactgcggcaggagggcttctccgac
cggatcgtcctgtgcacgctagaccggcaccttccctacgaccgtcccaagctcagcaag
tccctggacacacagcctgagcagctggccctgaggcccaaggagtttttccgagcctat
ggcatcgaggtgctcaccgaggctcaggtggtcacagtggacgtgagaactaagaaggtc
gtgttcaaggatggcttcaagctggagtacagcaagctgctgctggcaccagggagcagc
cccaagactctgagctgcaaaggcaaagaagtggagaacgtgttcactatccggacgcca
gaggatgccaatcgcgtggtgaggctggcccgaggccgcaacgtggtcgtcgtgggagcc
ggcttcctggggatggaggtggccgcttacctgacggagaaggcccactctgtgtctgtg
gtggagctggaggagacgcccttcaggaggttcctgggggagcgcgtgggtcgtgccctc
atgaagatgtttgagaacaaccgggtgaagttctacatgcagacggaggtgtctgagctg
cggggccaggagggaaagctgaaggaggttgtgctgaagagcagcaaggtcgtgcgggct
gacgtctgcgtggtgggcattggtgcagtgcccgccacaggcttcctgaggcaaagcggc
atcggtttggattcccgaggcttcatccctgtcaacaagatgatgcagaccaatgtccca
ggcgtgtttgcagctggcgatgctgtcaccttcccccttgcctggaggaacaaccgcaaa
gtgaacattccacattggcagatggctcatgctcaggggcgcgtggcagcccagaacatg
ttggcgcaggaggcggagatgagcactgtgccctacctctggaccgccatgtttggcaag
agcctgcgctacgcgggctacggagaaggcttcgacgacgtcatcatccagggggatctg
gaggagctgaagtttgtggctttttacactaaaggcgacgaggtgatcgccgtggccagc
atgaactacgatcccattgtgtccaaggtcgctgaggtgctggcctcaggccgtgccatc
cggaagcgggaggtggagctgtttgtgctgcacagcaagactggcgacatgtcctggctt
acggggaaaggatcctga

DBGET integrated database retrieval system