KEGG   Homo sapiens (human): 150275
Entry
150275            CDS       T01001                                 
Symbol
CCDC117, dJ366L4.1
Name
(RefSeq) coiled-coil domain containing 117
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCDC117 TSP1_ADAMTS
Other DBs
NCBI-GeneID: 150275
NCBI-ProteinID: NP_775781
HGNC: 26599
Ensembl: ENSG00000159873
Pharos: Q8IWD4(Tdark)
UniProt: Q8IWD4 A0A024R1C5
Position
22:28772695..28789301
AA seq 279 aa
MAALGRPFSGLPLSGGSDFLQPPQPAFPGRAFPPGADGAELAPRPGPRAVPSSPAGSAAR
GRVSVHCKKKHKREEEEDDDCPVRKKRITEAELCAGPNDWILCAHQDVEGHGVNPSVSGL
SIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDT
MKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHV
AAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL
NT seq 840 nt   +upstreamnt  +downstreamnt
atggctgcgctcggccggcccttcagcggcctccctctgagcggcggctcggacttcctg
cagccgccgcagccggccttccccggccgggccttcccgccgggggctgacggcgccgag
ttggccccgcggccgggacctcgcgcagtccctagcagtcccgctgggagtgcggcgcgc
ggacgtgtttctgttcactgtaaaaagaaacacaagcgagaggaggaggaggatgatgat
tgtccagtaagaaagaaaaggataactgaagcagagctctgtgctggtcctaatgactgg
attctttgtgcacatcaggatgtagaggggcatggagtaaatcccagtgttagtggcctt
tccatacctgggatattagatgttatttgtgaagaaatggatcagacaactggagaacca
cagtgtgaagttgcccgaaggaagcttcaggagattgaggacaggataattgatgaagat
gaagaagttgaagctgacagaaatgttaaccatctccccagtcttgtcctttctgatacc
atgaaaacaggtttgaagagggaatttgatgaagtttttacaaagaaaatgattgagtct
atgagccgtccttccatggagcttgttctctggaaacccctccctgaactcctttctgat
aagccaaagccatcctctaatactaagaactatacaggagagagccaagctaagcatgta
gctgctggcactgccttccctcagagaactgaactgttttcggaacctcggccaacaggg
atgtctctttataatagtttggagacagctactagcacagaagaagagatggaactctag

DBGET integrated database retrieval system