KEGG   Homo sapiens (human): 150290
Entry
150290            CDS       T01001                                 

Gene name
DUSP18, DSP18, DUSP20, LMWDSP20
Definition
(RefSeq) dual specificity phosphatase 18
  KO
K14165  atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    150290 (DUSP18)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     150290 (DUSP18)
    3.1.3.48  protein-tyrosine-phosphatase
     150290 (DUSP18)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    150290 (DUSP18)
SSDB
Motif
Pfam: DSPc Y_phosphatase
Other DBs
NCBI-GeneID: 150290
NCBI-ProteinID: NP_001291723
OMIM: 611446
HGNC: 18484
Ensembl: ENSG00000167065
Vega: OTTHUMG00000151115
Pharos: Q8NEJ0(Tdark)
UniProt: Q8NEJ0 A0A024R1L2
Structure
PDB: 
2ESB

Position
22q12.2
AA seq 188 aa
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTL
YEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEK
EVRLMIPL
NT seq 567 nt   +upstreamnt  +downstreamnt
atgacagcaccctcgtgtgccttcccagttcagttccggcagccctcagtcagcggcctc
tcgcagataaccaaaagcctgtatatcagcaatggtgtggccgccaacaacaagctcatg
ctgtctagcaaccagatcaccatggtcatcaatgtctcagtggaggtagtgaacaccttg
tatgaggatatccagtacatgcaggtacctgtggctgactcccctaactcacgtctctgt
gacttctttgaccctattgctgaccatatccacagcgtggagatgaagcagggccgtact
ttgctgcactgtgctgctggtgtgagccgctcagctgccctgtgcctcgcctacctcatg
aagtaccacgccatgtccctgctggacgcccacacgtggaccaagtcatgccggcccatc
atccgacccaacagcggcttttgggagcagctcatccactatgagttccaattgtttggc
aagaacactgtgcacatggtcagttccccagtgggaatgatccctgacatctatgagaag
gaagtccgtttgatgattccactgtga

DBGET integrated database retrieval system