KEGG   Homo sapiens (human): 150356
Entry
150356            CDS       T01001                                 
Symbol
CHADL, SLRR4B
Name
(RefSeq) chondroadherin like
  KO
K25758  chondroadherin-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    150356 (CHADL)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRR_5 LRRNT LRR_6 LRRCT
Other DBs
NCBI-GeneID: 150356
NCBI-ProteinID: NP_612490
OMIM: 616236
HGNC: 25165
Ensembl: ENSG00000100399
Pharos: Q6NUI6(Tbio)
UniProt: Q6NUI6
Position
22:complement(41229513..41240931)
AA seq 762 aa
MEGPRSSTHVPLVLPLLVLLLLAPARQAAAQRCPQACICDNSRRHVACRYQNLTEVPDAI
PELTQRLDLQGNLLKVIPAAAFQGVPHLTHLDLRHCEVELVAEGAFRGLGRLLLLNLASN
HLRELPQEALDGLGSLRRLELEGNALEELRPGTFGALGALATLNLAHNALVYLPAMAFQG
LLRVRWLRLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGPVLSQARGLARLELGHN
PLTYAGEEDGLALPGLRELLLDGGALQALGPRAFAHCPRLHTLDLRGNQLDTLPPLQGPG
QLRRLRLQGNPLWCGCQARPLLEWLARARVRSDGACQGPRRLRGEALDALRPWDLRCPGD
AAQEEEELEERAVAGPRAPPRGPPRGPGEERAVAPCPRACVCVPESRHSSCEGCGLQAVP
RGFPSDTQLLDLRRNHFPSVPRAAFPGLGHLVSLHLQHCGIAELEAGALAGLGRLIYLYL
SDNQLAGLSAAALEGAPRLGYLYLERNRFLQVPGAALRALPSLFSLHLQDNAVDRLAPGD
LGRTRALRWVYLSGNRITEVSLGALGPARELEKLHLDRNQLREVPTGALEGLPALLELQL
SGNPLRALRDGAFQPVGRSLQHLFLNSSGLEQICPGAFSGLGPGLQSLHLQKNQLRALPA
LPSLSQLELIDLSSNPFHCDCQLLPLHRWLTGLNLRVGATCATPPNARGQRVKAAAAVFE
DCPGWAARKAKRTPASRPSARRTPIKGRQCGADKVGKEKGRL
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggaggggccccggagctccacccatgtccccttggtgctgccgcttcttgtacttctg
ctgctggccccggctaggcaggccgccgcccagcgctgcccacaggcctgcatctgtgac
aactccaggcgacacgttgcctgccggtaccagaacctcactgaggtgccagacgccatc
cctgagctgacccagcggctggacctgcagggcaatttgctgaaggtgatccccgcagcc
gccttccagggcgtgcctcacctcacacacctggacctgcgccactgcgaggtggagctg
gtggccgagggcgccttccgtggcctgggccgcctgctcctgctcaacctggcctccaac
cacctgcgtgagctgccccaggaggcgctggacgggctgggctcgttgcggcggctggag
ctggaggggaacgcactggaggagctgcggccggggacgttcggggcactgggtgcgctg
gccacgctaaacctggcccacaacgccctggtttacctgcccgccatggccttccagggg
ctactgcgcgtccgctggctgcggctgtcgcacaacgcgctcagcgtgctggcccccgag
gccctggctggcctgcccgccctgagacggctcagcctacaccacaacgagctccaggct
ctgcccgggcctgtcttgtcccaggcccgcggcctggcccgtctggagctgggccacaac
ccgctcacctacgcgggcgaggaggacgggctggcgctgcccggcctgcgggagctgctg
ctggacggcggggccctgcaggccctgggtcccagggccttcgcacactgtccgcgcctg
cacaccctcgacctccgcgggaaccagctagacaccctgcccccgctgcagggcccgggc
cagctgcgccggctgcggctgcaggggaatccgctgtggtgcggctgccaggcgcggccc
ctactcgagtggctggcgcgggcgcgcgtgcgctcggacggcgcgtgccaggggccgcgg
cgcctgcggggcgaggctctggacgccctgcggccctgggacctgcgctgccctggggac
gcggcgcaggaagaggaagagctggaagagcgggctgtggccgggccccgcgcccctccg
cgcggccctccgcgcggccccggggaggagcgggcagtcgcgccttgccctcgcgcctgc
gtgtgcgtccccgagtcccggcacagcagctgcgagggctgcggcctgcaggcggtgccc
cgcggcttccccagcgacacccagctcctggacctgaggcggaaccacttcccctcggtg
ccccgagcggccttccccggcctgggccacctggtgtcgctgcacctgcagcactgcggc
atcgcggagctggaagcgggcgccctggccgggctgggccgcctgatctacctgtacctc
tccgacaaccagctcgcaggcctcagcgctgctgcccttgaaggggctccccgcctcggc
tacctgtacctagaacgcaaccgtttcctgcaggtgccaggggctgccctgcgcgccctg
cccagcctcttctccctgcacctgcaggacaacgctgtggaccgcctggcacctggggac
ctggggagaacacgggccttgcgctgggtctacctgagtggaaaccgcatcaccgaagtg
tcccttggggcgctgggcccagctcgggagctggagaagctgcacctggacaggaatcag
ctgcgagaggtgcccactggggccttggaggggctgcctgccctcctggagctgcagctc
tcgggcaacccactcagggccttgcgtgacggagccttccagcctgtgggcaggtcgctg
cagcacctcttcctgaacagcagtggcctggagcagatttgtcctggggccttttcaggc
ctggggcccgggctccagagcctgcacctgcagaagaaccagcttcgggccctgcctgcc
ctgcccagtctcagccagctggagctcatcgacctcagcagcaatcccttccactgtgac
tgccagctgcttccgctgcacaggtggcttactgggctgaacctgcgggtgggggccacc
tgcgccacccctcccaatgcccgtggccagagggtgaaggctgcagctgctgtctttgaa
gactgcccgggctgggctgccagaaaggccaagcggacaccagcctccaggcccagtgcc
aggagaacccccatcaaaggaagacagtgtggagcagataaggtggggaaggagaagggt
cgtctctga

DBGET integrated database retrieval system