KEGG   Homo sapiens (human): 150368
Entry
150368            CDS       T01001                                 

Gene name
PHETA2, FAM109B, IPIP27B, Ses2
Definition
(RefSeq) PH domain containing endocytic trafficking adaptor 2
  KO
K23791  sesquipedalian
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    150368 (PHETA2)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   Others
    150368 (PHETA2)
SSDB
Motif
Pfam: PH
Other DBs
NCBI-GeneID: 150368
NCBI-ProteinID: NP_001002034
OMIM: 614240
HGNC: 27161
Ensembl: ENSG00000177096
Vega: OTTHUMG00000151285
Pharos: Q6ICB4(Tbio)
UniProt: Q6ICB4
Position
22q13.2
AA seq 259 aa
MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREG
RAPLSLVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRAS
FGYMRLVVRELESQLQDARQSLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSS
PVGLVEEAGSRSAGWGLAEWELQGPASLLLGKGQSPVSPETSCFSTLHDWYGQEIVELRQ
CWQKRAQGSHSKCEEQDRP
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaagctgaacgagaggagtgtagcccactatgcactcagcgactccccagcggaccac
atgggcttcctgcgcacctgggggggcccagggaccccaccgacccccagtggcactggc
cgaagatgctggtttgtcctcaagggcaacctgctattctcctttgagagtcgcgagggc
cgggccccactgagcctggtggtgctggaaggctgcacagtggaactggccgaggctccc
gtgcccgaggagtttgcctttgccatctgctttgatgcccctggagtgcgcccacacctg
ctggccgcagaagggccggcggcccaggaggcctgggtgaaggtgctgtcccgggcaagc
tttggctacatgcgcctggtggtacgcgagttggagagccagttgcaggacgcacgccag
agcctggctttgcaacgccgctcatcctggaagtctgttgccagccgctgtaagccccag
gctcctaaccaccgagctgcgggcctggagaatggccactgcctctccaaggacagcagc
cctgtgggcttggttgaagaagcgggcagcaggtctgcagggtgggggttggctgagtgg
gagctgcagggccctgccagcctcctcctaggcaaggggcagagccctgtgtcccctgag
acctcctgcttctctaccctgcatgactggtatggccaggagatcgtggagctgcggcag
tgttggcagaagagggcccaggggagccactcaaaatgtgaggaacaggataggccctaa

DBGET integrated database retrieval system