KEGG   Homo sapiens (human): 150372
Entry
150372            CDS       T01001                                 

Gene name
NFAM1, CNAIP
Definition
(RefSeq) NFAT activating protein with ITAM motif 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF2567
Other DBs
NCBI-GeneID: 150372
NCBI-ProteinID: NP_666017
OMIM: 608740
HGNC: 29872
Ensembl: ENSG00000235568
Vega: OTTHUMG00000150923
Pharos: Q8NET5(Tbio)
UniProt: Q8NET5
Position
22q13.2
AA seq 270 aa
MENQPVRWRALPGLPRPPGLPAAPWLLLGVLLLPGTLRLAGGQSVTHTGLPIMASLANTA
ISFSCRITYPYTPQFKVFTVSYFHEDLQGQRSPKKPTNCHPGLGTENQSHTLDCQVTLVL
PGASATGTYYCSVHWPHSTVRGSGTFILVRDAGYREPPQSPQKLLLFGFTGLLSVLSVVG
TALLLWNKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGS
SPTAKQSPLSQERPHRFEDDGELNLVYENL
NT seq 813 nt   +upstreamnt  +downstreamnt
atggagaaccagcctgtgaggtggcgggccctgccaggcctcccacgccctcctgggctc
cccgcagccccctggctcctccttggcgtgctgctgctgcccgggaccctgcgactggca
ggaggacagtcagtgacccacaccggcctgcccatcatggcctccctggccaacacagct
atctccttcagctgcaggatcacctatccatacactccccaattcaaggttttcacagtc
agctactttcatgaagatctccagggacagaggagccctaagaagccaacaaactgccac
cctggactgggcacagagaaccagagccacaccctggactgccaggtcacccttgtgctg
ccgggagcatcggccactggcacctactactgctctgtccactggccacactccacggtg
agaggcagcggcaccttcatcctggtcagagacgcagggtaccgagagcccccgcagagt
ccacagaagctcctgctctttggcttcaccggcctcctgagtgtcctgagtgtagtgggc
acggccctgctgctctggaacaagaagcggatgcggggtccagggaaggaccccaccagg
aagtgcccagatccaagatctgccagcagccccaagcagcatccttcagaatctgtctac
acagctctgcagcgccgcgagaccgaggtctatgcctgcatcgagaatgaggatggcagc
tcacccaccgccaagcagagccccctctcccaggagagaccgcatagattcgaagatgat
ggcgaacttaacctggtctatgaaaatctctag

DBGET integrated database retrieval system