KEGG   Homo sapiens (human): 1504Help
Entry
1504              CDS       T01001                                 

Gene name
CTRB1, CTRB
Definition
(RefSeq) chymotrypsinogen B1
  KO
K01310  chymotrypsin [EC:3.4.21.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Drug target
Ulinastatin: D05183
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    1504 (CTRB1)
   04974 Protein digestion and absorption
    1504 (CTRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1504 (CTRB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     1504 (CTRB1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1504 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316
Motif
Other DBs
NCBI-GeneID: 1504
NCBI-ProteinID: NP_001897
OMIM: 118890
HGNC: 2521
Ensembl: ENSG00000168925
Vega: OTTHUMG00000159272
Pharos: P17538(Tchem)
UniProt: P17538
Position
16q23.1
AA seq 263 aa AA seqDB search
MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctctggctcctctcctgcttctcccttgtgggggccgcctttggctgcggg
gtccccgccatccaccctgtgctcagcggcctgtccaggatcgtgaatggggaggacgcc
gtccccggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
gggggctccctcatcagcgaggactgggtggtcaccgctgcccactgcggggtcaggacc
tccgacgtggtcgtggctggggagtttgaccagggctctgacgaggagaacatccaggtc
ctgaagatcgccaaggtcttcaagaaccccaagttcagcattctgaccgtgaacaatgac
atcaccctgctgaagctggccacacctgcccgcttctcccagacagtgtccgccgtgtgc
ctgcccagcgccgacgacgacttccccgcggggacactgtgtgccaccacaggctggggc
aagaccaagtacaacgccaacaagacccctgacaagctgcagcaggcagccctgcccctc
ctgtccaatgccgaatgcaagaagtcctggggcaggaggatcaccgacgtgatgatctgt
gccggggccagtggcgtctcctcctgcatgggcgactctggcggccccctggtctgccaa
aaggatggagcctggaccctggtgggcattgtgtcctggggcagcgacacctgctccacc
tccagccctggcgtgtacgcccgtgtcaccaagctcataccttgggtgcagaagatcctg
gctgccaactga

DBGET integrated database retrieval system