KEGG   Homo sapiens (human): 1506Help
Entry
1506              CDS       T01001                                 

Gene name
CTRL, CTRL1
Definition
(RefSeq) chymotrypsin like
  KO
K09632  chymotrypsin-like protease [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    1506 (CTRL)
   04974 Protein digestion and absorption
    1506 (CTRL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1506 (CTRL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     1506 (CTRL)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1506 (CTRL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316 Peptidase_C37
Motif
Other DBs
NCBI-GeneID: 1506
NCBI-ProteinID: NP_001898
OMIM: 118888
HGNC: 2524
Ensembl: ENSG00000141086
Vega: OTTHUMG00000137552
Pharos: P40313(Tchem)
UniProt: P40313 A0A024R6Z5
Position
16q22.1
AA seq 264 aa AA seqDB search
MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFC
GGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNN
DVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALP
LVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCN
VRAPAVYTRVSKFSTWINQVIAYN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctcagcctgaccctaagcctggttctcctcggctcctcctggggctgcggc
attcctgccatcaaaccggcactgagcttcagccagaggattgtcaacggggagaatgca
gtgttgggctcctggccctggcaggtgtccctgcaggacagcagcggcttccacttctgc
ggtggttctctcatcagccagtcctgggtggtcactgctgcccactgcaatgtcagccct
ggccgccattttgttgtcctgggcgagtatgaccgatcatcaaacgcagagcccttgcag
gttctgtccgtctctcgggccattacacaccctagctggaactctaccaccatgaacaat
gacgtgacgctgctgaagctcgcctcgccagcccagtacacaacacgcatctcgccagtt
tgcctggcatcctcaaacgaggctctgactgaaggcctcacgtgtgtcaccaccggctgg
ggtcgcctcagtggcgtgggcaatgtgacaccagcacatctgcagcaggtggctttgccc
ctggtcactgtgaatcagtgccggcagtactggggctcaagtatcactgactccatgatc
tgtgcaggtggcgcaggtgcctcctcgtgccagggtgactccggaggccctcttgtctgc
cagaagggaaacacatgggtgcttattggtattgtctcctggggcaccaaaaactgcaat
gtgcgcgcacctgctgtgtatactcgagttagcaagttcagcacctggatcaaccaggtc
atagcctacaactga

DBGET integrated database retrieval system