KEGG   Homo sapiens (human): 150678
Entry
150678            CDS       T01001                                 
Symbol
COPS9, CSNAP, MYEOV2
Name
(RefSeq) COP9 signalosome subunit 9
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MYEOV2
Other DBs
NCBI-GeneID: 150678
NCBI-ProteinID: NP_001156896
OMIM: 619349
HGNC: 21314
Ensembl: ENSG00000172428
Pharos: Q8WXC6(Tdark)
UniProt: Q8WXC6
Position
2:complement(240126548..240136347)
AA seq 57 aa
MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ
NT seq 174 nt   +upstreamnt  +downstreamnt
atgaagccggcggtggacgagatgttccccgagggcgccgggccctacgtggacctggac
gaggcgggaggcagcaccgggctcttgatggacttggcagccaatgaaaaggccgttcat
gcagacttttttaacgattttgaagatctttttgatgatgatgacatccagtga

DBGET integrated database retrieval system