KEGG   Homo sapiens (human): 150684Help
Entry
150684            CDS       T01001                                 

Gene name
COMMD1, C2orf5, MURR1
Definition
(RefSeq) copper metabolism domain containing 1
  KO
K22557  COMM domain containing 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    150684 (COMMD1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    150684 (COMMD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COMMD1_N COMM_domain DUF4476 SelB-wing_2
Motif
Other DBs
NCBI-GeneID: 150684
NCBI-ProteinID: NP_689729
OMIM: 607238
HGNC: 23024
Ensembl: ENSG00000173163
Vega: OTTHUMG00000129445
Pharos: Q8N668(Tbio)
UniProt: Q8N668
Structure
PDB: 

Position
2p15
AA seq 190 aa AA seqDB search
MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILK
SIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLR
GLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEE
SISTLISQPN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggcgagcttgagggtggcaaacccctgagcgggctgctgaatgcgctggcc
caggacactttccacgggtaccccggcatcacagaggagctgctacggagccagctatat
ccagaggtgccacccgaggagttccgcccctttctggcaaagatgagggggattcttaag
tctattgcgtctgcagacatggatttcaaccagctggaggcattcttgactgctcaaacc
aaaaagcaaggtgggatcacatctgaccaagctgctgtcatttccaaattctggaagagc
cacaagacaaaaatccgtgagagcctcatgaaccagagccgctggaatagcgggcttcgg
ggcctgagctggagagttgatggcaagtctcagtcaaggcactcagctcaaatacacaca
cctgttgccattatagagctggaattaggcaaatatggacaggaatctgaatttctgtgt
ttggaatttgatgaggtcaaagtcaaccaaattctgaagacgctgtcagaggtagaagaa
agtatcagcacactgatcagccagcctaactga

DBGET integrated database retrieval system