KEGG   Homo sapiens (human): 150737
Entry
150737            CDS       T01001                                 

Gene name
TTC30B, IFT70, IFT70B, fleer
Definition
(RefSeq) tetratricopeptide repeat domain 30B
  KO
K19683  tetratricopeptide repeat protein 30
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    150737 (TTC30B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    150737 (TTC30B)
SSDB
Motif
Pfam: TPR_19 TPR_2 TPR_1 TPR_7 ANAPC3 TPR_16 TPR_20 TPR_6
Other DBs
NCBI-GeneID: 150737
NCBI-ProteinID: NP_689730
HGNC: 26425
Ensembl: ENSG00000196659
Vega: OTTHUMG00000154166
Pharos: Q8N4P2(Tdark)
UniProt: Q8N4P2
Position
2q31.2
AA seq 665 aa
MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQE
FALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQA
AIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAA
LQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVG
NTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDA
RPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYD
FLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETM
EKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIG
FYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKM
YHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKH
TIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEI
IGWNI
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggctggcctgagcggcgcgcagatccccgacggggagttcaccgcggtcgtgtaccgc
ctcatccgcaatgcacgctacgccgaggcggtgcagctgctgggcggagaactgcagcgg
agccctaggagccgcgccggcctgtcgctgctaggctactgctactaccgcctgcaggag
ttcgcgctggcggccgagtgctatgagcagctgggccagctgcacccggaactggagcag
taccgcctgtaccaggcccaggccctgtacaaggcctgcctttatgcggaggccacccgg
gtcgccttccttctcctggataaccccgcctaccacagccgggtcctccgcctgcaagct
gctatcaagtacagcgagggcgatctgccagggtccaggagcctggtagagcagctgccg
agtagggaagggggagaggaaagtgggggcgagaatgagaccgatggccagatcaacctg
ggttgtttgctctacaaggagggacagtatgaagctgcatgctccaagttttttgccgcc
ctgcaggcctcgggctaccagcctgacctttcctacaacctggctttggcctattacagc
agccgacagtatgcttcagcactgaagcatatcgctgagattattgagcgtggcatccgc
cagcaccctgagctaggtgtgggcatgaccactgagggcattgatgttcgcagtgttggc
aacaccttagtcctccatcagactgctctggtggaagccttcaaccttaaggcagctata
gaataccaactgagaaactatgaggcagctcaagaagccctcactgacatgccacccagg
gcagaggaagagttggaccctgtgaccctacacaaccaggcactaatgaacatggatgcc
aggcctacagaagggtttgaaaagctacagtttttgctccaacagaatccctttcctcca
gagacttttggcaacctgttgctgctctactgtaaatatgagtattttgacctggcagca
gatgtcctggcagaaaatgcccatttgatttataagttcctcacaccctatctctatgac
ttcttggacgctgtgatcacttgccagacagctcctgaagaggctttcattaagcttgat
gggctagcagggatgctgactgaggtcctccggaaacttaccatacaagtacaggaagca
agacacaatagagatgatgaagctatcaaaaaggcagtgaatgaatatgatgaaaccatg
gagaaatacattcctgtgttgatggctcaggcaaaaatctactggaatcttgaaaattat
ccaatggtggaaaagatcttccgcaaatctgtggaattctgtaacgaccatgatgtgtgg
aagttgaatgtggctcatgttctgttcatgcaggaaaacaaatacaaagaagccattggt
ttctatgaacccatagtcaagaagcattatgataacatcctgaatgtcagtgctattgta
ctggctaatctctgtgtttcctatattatgacaagtcaaaatgaagaagcagaggagttg
atgaggaagattgaaaaggaggaagagcagctctcttatgatgacccagataagaaaatg
taccatctctgcattgtgaatttggtgataggaactctttattgtgccaaaggaaattat
gactttggtatttctcgagttatcaaaagcttggaaccttacaacaaaaagctgggaaca
gacacctggtattatgccaaaagatgcttcctgtccttgttagaaaacatgtcaaaacac
acaatcatgcttcgtgatagtgttattcaagaatgtgtccagtttctagaacactgtgaa
cttcatggcagaaacatacctgctgttattgaacaacccctggaagaagaaagaatgcat
gttggaaagaatacagtcacatatgagtctaggcagttaaaagctttgatttatgagatt
ataggatggaatatatag

DBGET integrated database retrieval system