KEGG   Homo sapiens (human): 150737
Entry
150737            CDS       T01001                                 
Symbol
IFT70B, IFT70, TTC30B, fleer
Name
(RefSeq) intraflagellar transport 70B
  KO
K19683  tetratricopeptide repeat protein 30
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    150737 (IFT70B)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Intraflagellar transport (IFT) complex B1
   150737 (IFT70B)
SSDB
Motif
Pfam: TPR_2 TPR_19 TPR_1 TPR_16 ANAPC3 TPR_6 TPR_10 YfiO Ribosomal_S16
Other DBs
NCBI-GeneID: 150737
NCBI-ProteinID: NP_689730
OMIM: 620742
HGNC: 26425
Ensembl: ENSG00000196659
UniProt: Q8N4P2
Position
2:complement(177548998..177552796)
AA seq 665 aa
MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQE
FALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQA
AIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAA
LQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVG
NTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDA
RPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYD
FLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETM
EKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIG
FYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKM
YHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKH
TIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEI
IGWNI
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggctggcctgagcggcgcgcagatccccgacggggagttcaccgcggtcgtgtaccgc
ctcatccgcaatgcacgctacgccgaggcggtgcagctgctgggcggagaactgcagcgg
agccctaggagccgcgccggcctgtcgctgctaggctactgctactaccgcctgcaggag
ttcgcgctggcggccgagtgctatgagcagctgggccagctgcacccggaactggagcag
taccgcctgtaccaggcccaggccctgtacaaggcctgcctttatgcggaggccacccgg
gtcgccttccttctcctggataaccccgcctaccacagccgggtcctccgcctgcaagct
gctatcaagtacagcgagggcgatctgccagggtccaggagcctggtagagcagctgccg
agtagggaagggggagaggaaagtgggggcgagaatgagaccgatggccagatcaacctg
ggttgtttgctctacaaggagggacagtatgaagctgcatgctccaagttttttgccgcc
ctgcaggcctcgggctaccagcctgacctttcctacaacctggctttggcctattacagc
agccgacagtatgcttcagcactgaagcatatcgctgagattattgagcgtggcatccgc
cagcaccctgagctaggtgtgggcatgaccactgagggcattgatgttcgcagtgttggc
aacaccttagtcctccatcagactgctctggtggaagccttcaaccttaaggcagctata
gaataccaactgagaaactatgaggcagctcaagaagccctcactgacatgccacccagg
gcagaggaagagttggaccctgtgaccctacacaaccaggcactaatgaacatggatgcc
aggcctacagaagggtttgaaaagctacagtttttgctccaacagaatccctttcctcca
gagacttttggcaacctgttgctgctctactgtaaatatgagtattttgacctggcagca
gatgtcctggcagaaaatgcccatttgatttataagttcctcacaccctatctctatgac
ttcttggacgctgtgatcacttgccagacagctcctgaagaggctttcattaagcttgat
gggctagcagggatgctgactgaggtcctccggaaacttaccatacaagtacaggaagca
agacacaatagagatgatgaagctatcaaaaaggcagtgaatgaatatgatgaaaccatg
gagaaatacattcctgtgttgatggctcaggcaaaaatctactggaatcttgaaaattat
ccaatggtggaaaagatcttccgcaaatctgtggaattctgtaacgaccatgatgtgtgg
aagttgaatgtggctcatgttctgttcatgcaggaaaacaaatacaaagaagccattggt
ttctatgaacccatagtcaagaagcattatgataacatcctgaatgtcagtgctattgta
ctggctaatctctgtgtttcctatattatgacaagtcaaaatgaagaagcagaggagttg
atgaggaagattgaaaaggaggaagagcagctctcttatgatgacccagataagaaaatg
taccatctctgcattgtgaatttggtgataggaactctttattgtgccaaaggaaattat
gactttggtatttctcgagttatcaaaagcttggaaccttacaacaaaaagctgggaaca
gacacctggtattatgccaaaagatgcttcctgtccttgttagaaaacatgtcaaaacac
acaatcatgcttcgtgatagtgttattcaagaatgtgtccagtttctagaacactgtgaa
cttcatggcagaaacatacctgctgttattgaacaacccctggaagaagaaagaatgcat
gttggaaagaatacagtcacatatgagtctaggcagttaaaagctttgatttatgagatt
ataggatggaatatatag

DBGET integrated database retrieval system