KEGG   Homo sapiens (human): 150864
Entry
150864            CDS       T01001                                 

Gene name
FAM117B, ALS2CR13
Definition
(RefSeq) family with sequence similarity 117 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM117
Other DBs
NCBI-GeneID: 150864
NCBI-ProteinID: NP_775782
HGNC: 14440
Ensembl: ENSG00000138439
Vega: OTTHUMG00000154550
Pharos: Q6P1L5(Tdark)
UniProt: Q6P1L5 Q7Z3M2
Position
2q33.2
AA seq 589 aa
MSQRVRRNGSPTPAGSLGGGAVATAGGPGSRLQPMRATVPFQLKQQQQQQHGSPTRSGGG
GGGNNNGGCCGGASGPAGGGGGGGPRTASRSTSPTRGGGNAAARTSPTVATQTGASATST
RGTSPTRSAAPGARGSPPRPPPPPPLLGTVSSPSSSPTHLWTGEVSAAPPPARVRHRRRS
PEQSRSSPEKRSPSAPVCKAGDKTRQPSSSPSSIIRRTSSLDTLAAPYLAGHWPRDSHGQ
AAPCMRDKATQTESAWAEEYSEKKKGSHKRSASWGSTDQLKEIAKLRQQLQRSKHSSRHH
RDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKET
GEKEEQLIPQDIPDGHRAPPPLVQRSSSTRSIDTQTPGGADRGSNNSSRSQSVSPTSFLT
ISNEGSEESPCSADDLLVDPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVF
EECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTT
GMTTTLLQPIAVASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEEAEG
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgtcccagcgggtgaggcgcaatgggtcccccacgccggccggctcccttgggggtggt
gcggtggccacggccgggggacccgggagccgcttgcagcccatgagggcgacggttccg
ttccagctgaagcagcagcagcagcagcaacatggcagccccacgcggagcggcggcggc
ggcggcggcaacaacaacggtggctgctgtggtggcgcctcaggccccgcaggcggcggc
ggcggcggtggcccgcgcaccgcctcgcgcagcaccagccccacgcgcggcggcgggaac
gcggccgcgcgcaccagccccacggtggccacgcagacgggcgcgtccgcgacgtccacg
cgaggcaccagccccacgcgcagcgccgcgcctggagctcgcgggagccccccacggccg
ccgccgccgccgccgctgctgggcaccgtgtcgtcgcccagctcgtcgcccacccacctg
tggaccggcgaggtgagcgcggccccacccccagcccgcgtccggcatcggaggaggtct
ccggagcagagccgaagctcgccggagaagaggagccccagcgccccggtttgcaaagca
ggtgacaaaacacgacagccttcttcaagcccctccagtattatccgacgcacttcctcc
ctggatactcttgctgcaccgtatcttgctggacactggcctcgggatagccatgggcaa
gctgcaccttgcatgagggacaaagctacacagacagagagtgcatgggctgaagaatac
tctgaaaagaagaaagggtctcacaagcgctcagcatcttggggcagtacagatcaactt
aaggagattgcaaaattacgccagcagttgcagagaagtaaacacagcagtcggcatcat
cgagataaagaaagacagtctccatttcatggcaaccatgcagctattaaccagtgtcag
gctcctgttccaaagagtgcacttattcctgtaattcccatcaccaaatcaacaggctcc
cggttccggaatagcgtggaaggattgaatcaggagattgaaataataattaaagagact
ggggaaaaggaagagcaacttataccgcaagatattccagatggccatcgtgctccaccc
ccccttgtacagagaagtagcagcacgcgcagcattgacacacagacgcctggtggggca
gacaggggaagcaacaacagcagccgttcccagtccgtgtccccaacatcgttcctcacc
atttccaatgaaggtagcgaggagagtccttgctcagcggatgacctgcttgttgatccc
agagataaagagaatgggaacaattctcctttgcccaaatatgcaacctcaccaaaacct
aacaacagttatatgttcaaaagggaacctcctgagggctgtgaaagggtcaaagtcttt
gaggaatgctcgccaaaacagcttcatgaaatcccagccttttattgtcctgacaaaaac
aaggtgaatttcattcctaaaagtggatctgctttctgcctcgtcagcatcctcaagcca
ctccttcctaccccggatcttacactcaagggctctggccacagcctgacagtcaccact
ggcatgacaaccactctgctgcagcctattgctgtggcctccctgtctacaaacacagag
caagaccgagtctctcgaggaacaagtacagtcatgccatcagcttctctactcccacca
ccagaaccaattgaggaagctgaaggatag

DBGET integrated database retrieval system