KEGG   Homo sapiens (human): 1509Help
Entry
1509              CDS       T01001                                 

Gene name
CTSD, CLN10, CPSD, HEL-S-130P
Definition
(RefSeq) cathepsin D
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04140  Autophagy - animal
hsa04142  Lysosome
hsa04210  Apoptosis
hsa04915  Estrogen signaling pathway
hsa05152  Tuberculosis
Network
N00286  Nuclear-initiated estrogen signaling pathway
Disease
H00149  Neuronal ceroid lipofuscinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    1509 (CTSD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1509 (CTSD)
   04140 Autophagy - animal
    1509 (CTSD)
  09143 Cell growth and death
   04210 Apoptosis
    1509 (CTSD)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    1509 (CTSD)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    1509 (CTSD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1509 (CTSD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1509 (CTSD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     1509 (CTSD)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   1509 (CTSD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1509 (CTSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Motif
Other DBs
NCBI-GeneID: 1509
NCBI-ProteinID: NP_001900
OMIM: 116840
HGNC: 2529
Ensembl: ENSG00000117984
Vega: OTTHUMG00000044760
Pharos: P07339(Tchem)
UniProt: P07339 V9HWI3
Structure
PDB: 

Position
11p15.5
AA seq 412 aa AA seqDB search
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctccagccttctgccgctcgccctctgcctgctggctgcacccgcctccgcg
ctcgtcaggatcccgctgcacaagttcacgtccatccgccggaccatgtcggaggttggg
ggctctgtggaggacctgattgccaaaggccccgtctcaaagtactcccaggcggtgcca
gccgtgaccgaggggcccattcccgaggtgctcaagaactacatggacgcccagtactac
ggggagattggcatcgggacgcccccccagtgcttcacagtcgtcttcgacacgggctcc
tccaacctgtgggtcccctccatccactgcaaactgctggacatcgcttgctggatccac
cacaagtacaacagcgacaagtccagcacctacgtgaagaatggtacctcgtttgacatc
cactatggctcgggcagcctctccgggtacctgagccaggacactgtgtcggtgccctgc
cagtcagcgtcgtcagcctctgccctgggcggtgtcaaagtggagaggcaggtctttggg
gaggccaccaagcagccaggcatcaccttcatcgcagccaagttcgatggcatcctgggc
atggcctacccccgcatctccgtcaacaacgtgctgcccgtcttcgacaacctgatgcag
cagaagctggtggaccagaacatcttctccttctacctgagcagggacccagatgcgcag
cctgggggtgagctgatgctgggtggcacagactccaagtattacaagggttctctgtcc
tacctgaatgtcacccgcaaggcctactggcaggtccacctggaccaggtggaggtggcc
agcgggctgaccctgtgcaaggagggctgtgaggccattgtggacacaggcacttccctc
atggtgggcccggtggatgaggtgcgcgagctgcagaaggccatcggggccgtgccgctg
attcagggcgagtacatgatcccctgtgagaaggtgtccaccctgcccgcgatcacactg
aagctgggaggcaaaggctacaagctgtccccagaggactacacgctcaaggtgtcgcag
gccgggaagaccctctgcctgagcggcttcatgggcatggacatcccgccacccagcggg
ccactctggatcctgggcgacgtcttcatcggccgctactacactgtgtttgaccgtgac
aacaacagggtgggcttcgccgaggctgcccgcctctag

DBGET integrated database retrieval system