KEGG   Homo sapiens (human): 1511Help
Entry
1511              CDS       T01001                                 

Gene name
CTSG, CATG, CG
Definition
(RefSeq) cathepsin G
  KO
K01319  cathepsin G [EC:3.4.21.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04142  Lysosome
hsa04614  Renin-angiotensin system
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1511 (CTSG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1511 (CTSG)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    1511 (CTSG)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    1511 (CTSG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1511 (CTSG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1511 (CTSG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1511 (CTSG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     1511 (CTSG)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   1511 (CTSG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Others
   1511 (CTSG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 1511
NCBI-ProteinID: NP_001902
OMIM: 116830
HGNC: 2532
Ensembl: ENSG00000100448
Vega: OTTHUMG00000140182
Pharos: P08311(Tchem)
UniProt: P08311
Structure
PDB: 

Position
14q12
AA seq 255 aa AA seqDB search
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcagccactcctgcttctgctggcctttctcctacccactggggctgaggcaggggag
atcatcggaggccgggagagcaggccccactcccgcccctacatggcgtatcttcagatc
cagagtccagcaggtcagagcagatgtggagggttcctggtgcgagaagactttgtgctg
acagcagctcattgctggggaagcaatataaatgtcaccctgggcgcccacaatatccag
agacgggaaaacacccagcaacacatcactgcgcgcagagccatccgccaccctcaatat
aatcagcggaccatccagaatgacatcatgttattgcagctgagcagaagagtcagacgg
aatcgaaacgtgaacccagtggctctgcctagagcccaggagggactgagacccgggacg
ctgtgcactgtggccggctggggcagggtcagcatgaggaggggaacagatacactccga
gaggtgcagctgagagtgcagagggataggcagtgcctccgcatcttcggttcctacgac
ccccgaaggcagatttgtgtgggggaccggcgggaacggaaggctgccttcaagggggat
tccggaggccccctgctgtgtaacaatgtggcccacggcatcgtctcctatggaaagtcg
tcaggggttcctccagaagtcttcaccagggtctcaagtttcctgccctggataaggaca
acaatgagaagcttcaaactgctggatcagatggagacccccctgtga

DBGET integrated database retrieval system