KEGG   Homo sapiens (human): 1513Help
Entry
1513              CDS       T01001                                 

Gene name
CTSK, CTS02, CTSO, CTSO1, CTSO2, PKND, PYCD
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa05323  Rheumatoid arthritis
Disease
H00273  Pycnodysostosis
H00425  Lysosomal cysteine protease deficiencies
Drug target
Odanacatib: D08955
Relacatib: D06634
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1513 (CTSK)
  09143 Cell growth and death
   04210 Apoptosis
    1513 (CTSK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    1513 (CTSK)
  09158 Development
   04380 Osteoclast differentiation
    1513 (CTSK)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    1513 (CTSK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1513 (CTSK)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1513 (CTSK)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     1513 (CTSK)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1513 (CTSK)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Papain family
   1513 (CTSK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 1513
NCBI-ProteinID: NP_000387
OMIM: 601105
HGNC: 2536
Ensembl: ENSG00000143387
Vega: OTTHUMG00000035008
Pharos: P43235(Tchem)
UniProt: P43235
Structure
PDB: 

Position
1q21.3
AA seq 329 aa AA seqDB search
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggctcaaggttctgctgctacctgtggtgagctttgctctgtaccctgaggag
atactggacacccactgggagctatggaagaagacccacaggaagcaatataacaacaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagtatatttccatccat
aaccttgaggcttctcttggtgtccatacatatgaactggctatgaaccacctgggggac
atgaccagtgaagaggtggttcagaagatgactggactcaaagtacccctgtctcattcc
cgcagtaatgacaccctttatatcccagaatgggaaggtagagccccagactctgtcgac
tatcgaaagaaaggatatgttactcctgtcaaaaatcagggtcagtgtggttcctgttgg
gcttttagctctgtgggtgccctggagggccaactcaagaagaaaactggcaaactctta
aatctgagtccccagaacctagtggattgtgtgtctgagaatgatggctgtggagggggc
tacatgaccaatgccttccaatatgtgcagaagaaccggggtattgactctgaagatgcc
tacccatatgtgggacaggaagagagttgtatgtacaacccaacaggcaaggcagctaaa
tgcagagggtacagagagatccccgaggggaatgagaaagccctgaagagggcagtggcc
cgagtgggacctgtctctgtggccattgatgcaagcctgacctccttccagttttacagc
aaaggtgtgtattatgatgaaagctgcaatagcgataatctgaaccatgcagttttggca
gtgggatatggaatccagaagggaaacaagcactggataattaaaaacagctggggagaa
aactggggaaacaaaggatatatcctcatggctcgaaataagaacaacgcctgtggcatt
gccaacctggccagcttccccaagatgtga

DBGET integrated database retrieval system