KEGG   Homo sapiens (human): 1513Help
Entry
1513              CDS       T01001                                 

Gene name
CTSK, CTS02, CTSO, CTSO1, CTSO2, PKND, PYCD
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa05323  Rheumatoid arthritis
Disease
H00273  Pycnodysostosis
H00425  Lysosomal cysteine protease deficiencies
Drug target
Odanacatib: D08955
Relacatib: D06634
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1513 (CTSK)
  09143 Cell growth and death
   04210 Apoptosis
    1513 (CTSK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    1513 (CTSK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1513 (CTSK)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    1513 (CTSK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1513 (CTSK)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1513 (CTSK)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     1513 (CTSK)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C1: papain family
   1513 (CTSK)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Papain family
   1513 (CTSK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 1513
NCBI-ProteinID: NP_000387
OMIM: 601105
HGNC: 2536
Ensembl: ENSG00000143387
Vega: OTTHUMG00000035008
Pharos: P43235(Tchem)
UniProt: P43235
Structure
PDB: 

Position
1q21.3
AA seq 329 aa AA seqDB search
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggctcaaggttctgctgctacctgtggtgagctttgctctgtaccctgaggag
atactggacacccactgggagctatggaagaagacccacaggaagcaatataacaacaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagtatatttccatccat
aaccttgaggcttctcttggtgtccatacatatgaactggctatgaaccacctgggggac
atgaccagtgaagaggtggttcagaagatgactggactcaaagtacccctgtctcattcc
cgcagtaatgacaccctttatatcccagaatgggaaggtagagccccagactctgtcgac
tatcgaaagaaaggatatgttactcctgtcaaaaatcagggtcagtgtggttcctgttgg
gcttttagctctgtgggtgccctggagggccaactcaagaagaaaactggcaaactctta
aatctgagtccccagaacctagtggattgtgtgtctgagaatgatggctgtggagggggc
tacatgaccaatgccttccaatatgtgcagaagaaccggggtattgactctgaagatgcc
tacccatatgtgggacaggaagagagttgtatgtacaacccaacaggcaaggcagctaaa
tgcagagggtacagagagatccccgaggggaatgagaaagccctgaagagggcagtggcc
cgagtgggacctgtctctgtggccattgatgcaagcctgacctccttccagttttacagc
aaaggtgtgtattatgatgaaagctgcaatagcgataatctgaaccatgcagttttggca
gtgggatatggaatccagaagggaaacaagcactggataattaaaaacagctggggagaa
aactggggaaacaaaggatatatcctcatggctcgaaataagaacaacgcctgtggcatt
gccaacctggccagcttccccaagatgtga

DBGET integrated database retrieval system