KEGG   Homo sapiens (human): 151306
Entry
151306            CDS       T01001                                 

Gene name
GPBAR1, BG37, GPCR19, GPR131, M-BAR, TGR5
Definition
(RefSeq) G protein-coupled bile acid receptor 1
  KO
K08400  G protein-coupled bile acid receptor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    151306 (GPBAR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Bile acid
    151306 (GPBAR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 151306
NCBI-ProteinID: NP_001070659
OMIM: 610147
HGNC: 19680
Ensembl: ENSG00000179921
Vega: OTTHUMG00000155203
Pharos: Q8TDU6(Tchem)
UniProt: Q8TDU6
Position
2q35
AA seq 330 aa
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
NT seq 993 nt   +upstreamnt  +downstreamnt
atgacgcccaacagcactggcgaggtgcccagccccattcccaagggggctttggggctc
tccctggccctggcaagcctcatcatcaccgcgaacctgctcctagccctgggcatcgcc
tgggaccgccgcctgcgcagcccacctgctggctgcttcttcctgagcctactgctggct
gggctgctcacgggtctggcattgcccacattgccagggctgtggaaccagagtcgccgg
ggttactggtcctgcctcctcgtctacttggctcccaacttctccttcctctccctgctt
gccaacctcttgctggtgcacggggagcgctacatggcagtcctgaggccactccagccc
cctgggagcattcggctggccctgctcctcacctgggctggtcccctgctctttgccagt
ctgcccgctctggggtggaaccactggacccctggtgccaactgcagctcccaggctatc
ttcccagccccctacctgtacctcgaagtctatgggctcctgctgcccgccgtgggtgct
gctgccttcctctctgtccgcgtgctggccactgcccaccgccagctgcaggacatctgc
cggctggagcgggcagtgtgccgcgatgagccctccgccctggcccgggcccttacctgg
aggcaggcaagggcacaggctggagccatgctgctcttcgggctgtgctgggggccctac
gtggccacactgctcctctcagtcctggcctatgagcagcgcccgccactggggcctggg
acactgttgtccctcctctccctaggaagtgccagtgcagcggcagtgcccgtagccatg
gggctgggcgatcagcgctacacagccccctggagggcagccgcccaaaggtgcctgcag
gggctgtggggaagagcctcccgggacagtcccggccccagcattgcctaccacccaagc
agccaaagcagtgtcgacctggacttgaactaa

DBGET integrated database retrieval system