KEGG   Homo sapiens (human): 151449Help
Entry
151449            CDS       T01001                                 

Gene name
GDF7, BMP12
Definition
(RefSeq) growth differentiation factor 7
  KO
K20013  growth differentiation factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    151449 (GDF7)
   04390 Hippo signaling pathway
    151449 (GDF7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    151449 (GDF7)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    151449 (GDF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    151449 (GDF7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   151449 (GDF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 151449
NCBI-ProteinID: NP_878248
OMIM: 604651
HGNC: 4222
Ensembl: ENSG00000143869
Vega: OTTHUMG00000090781
Pharos: Q7Z4P5(Tbio)
UniProt: Q7Z4P5 Q75RY1
Position
2p24.1
AA seq 450 aa AA seqDB search
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAA
AVPAAAVPRARAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADT
ITGFTDQATQDESAAETGQSFLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLL
LLSTCPGAARAPRLLYSRAAEPLVGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGP
VPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPL
PDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKE
LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARL
SPISILYIDAANNVVYKQYEDMVVEACGCR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggacctgagcgccgccgccgcgctgtgcctttggctgctgagcgcctgccgcccccgc
gacgggctggaagcggccgccgtgctgcgagcggcgggggctgggccggtccggagccca
gggggcggcggcggcggcggcggcggcgggcggactcttgcccaggctgcgggcgccgcg
gctgtcccggccgccgcggttccccgggcccgcgccgcgcgccgcgccgcgggctccggc
ttcaggaacggctcggtggtgccgcaccacttcatgatgtcgctttaccggagcctggcc
gggagggctccggccggggcagccgctgtctccgcctcgggccatggtcgcgcggacacg
atcaccggcttcacagaccaggcgacccaagacgaatcggcagccgaaacaggccagagc
ttcctgttcgacgtgtccagccttaacgacgcagacgaggtggtgggtgccgagctgcgc
gtgctgcgccggggatctccagagtcgggcccaggcagctggacttctccgccgttgctg
ctgctgtccacgtgcccgggcgccgcccgagcgccacgcctgctgtactcgcgggcagct
gagcccctagtcggtcagcgctgggaggcgttcgacgtggcggacgccatgaggcgccac
cgtcgtgaaccgcgccccccccgcgcgttctgcctcttgctgcgcgcagtggcaggcccg
gtgccgagcccgttggcactgcggcggctgggcttcggctggccgggcggagggggctct
gcggcagaggagcgcgcggtgctagtcgtctcctcccgcacgcagaggaaagagagctta
ttccgggagatccgcgcccaggcccgcgcgctcggggccgctctggcctcagagccgctg
cccgacccaggaaccggcaccgcgtcgccaagggcagtcattggcggccgcagacggagg
aggacggcgttggccgggacgcggacagcgcagggcagcggcgggggcgcgggccggggc
cacgggcgcaggggccggagccgctgcagccgcaagccgttgcacgtggacttcaaggag
ctcggctgggacgactggatcatcgcgccgctggactacgaggcgtaccactgcgagggc
ctttgcgacttccctttgcgttcgcacctcgagcccaccaaccatgccatcattcagacg
ctgctcaactccatggcaccagacgcggcgccggcctcctgctgtgtgccagcgcgcctc
agccccatcagcatcctctacatcgacgccgccaacaacgttgtctacaagcaatacgag
gacatggtggtggaggcctgcggctgcaggtag

DBGET integrated database retrieval system