KEGG   Homo sapiens (human): 151449Help
Entry
151449            CDS       T01001                                 

Gene name
GDF7, BMP12
Definition
(RefSeq) growth differentiation factor 7
  KO
K20013  growth differentiation factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    151449 (GDF7)
   04390 Hippo signaling pathway
    151449 (GDF7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    151449 (GDF7)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    151449 (GDF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    151449 (GDF7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   151449 (GDF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 151449
NCBI-ProteinID: NP_878248
OMIM: 604651
HGNC: 4222
Ensembl: ENSG00000143869
Vega: OTTHUMG00000090781
Pharos: Q7Z4P5(Tbio)
UniProt: Q7Z4P5 Q75RY1
Position
2p24.1
AA seq 450 aa AA seqDB search
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAA
AVPAAAVPRARAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADT
ITGFTDQATQDESAAETGQSFLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLL
LLSTCPGAARAPRLLYSRAAEPLVGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGP
VPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPL
PDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKE
LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARL
SPISILYIDAANNVVYKQYEDMVVEACGCR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggacctgagcgccgccgccgcgctgtgcctttggctgctgagcgcctgccgcccccgc
gacgggctggaagcggccgccgtgctgcgagcggcgggggctgggccggtccggagccca
gggggcggcggcggcggcggcggcggcgggcggactcttgcccaggctgcgggcgccgcg
gctgtcccggccgccgcggttccccgggcccgcgccgcgcgccgcgccgcgggctccggc
ttcaggaacggctcggtggtgccgcaccacttcatgatgtcgctttaccggagcctggcc
gggagggctccggccggggcagccgctgtctccgcctcgggccatggtcgcgcggacacg
atcaccggcttcacagaccaggcgacccaagacgaatcggcagccgaaacaggccagagc
ttcctgttcgacgtgtccagccttaacgacgcagacgaggtggtgggtgccgagctgcgc
gtgctgcgccggggatctccagagtcgggcccaggcagctggacttctccgccgttgctg
ctgctgtccacgtgcccgggcgccgcccgagcgccacgcctgctgtactcgcgggcagct
gagcccctagtcggtcagcgctgggaggcgttcgacgtggcggacgccatgaggcgccac
cgtcgtgaaccgcgccccccccgcgcgttctgcctcttgctgcgcgcagtggcaggcccg
gtgccgagcccgttggcactgcggcggctgggcttcggctggccgggcggagggggctct
gcggcagaggagcgcgcggtgctagtcgtctcctcccgcacgcagaggaaagagagctta
ttccgggagatccgcgcccaggcccgcgcgctcggggccgctctggcctcagagccgctg
cccgacccaggaaccggcaccgcgtcgccaagggcagtcattggcggccgcagacggagg
aggacggcgttggccgggacgcggacagcgcagggcagcggcgggggcgcgggccggggc
cacgggcgcaggggccggagccgctgcagccgcaagccgttgcacgtggacttcaaggag
ctcggctgggacgactggatcatcgcgccgctggactacgaggcgtaccactgcgagggc
ctttgcgacttccctttgcgttcgcacctcgagcccaccaaccatgccatcattcagacg
ctgctcaactccatggcaccagacgcggcgccggcctcctgctgtgtgccagcgcgcctc
agccccatcagcatcctctacatcgacgccgccaacaacgttgtctacaagcaatacgag
gacatggtggtggaggcctgcggctgcaggtag

KEGG   Homo sapiens (human): 268Help
Entry
268               CDS       T01001                                 

Gene name
AMH, MIF, MIS
Definition
(RefSeq) anti-Mullerian hormone
  KO
K04665  anti-mullerian hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Module
hsa_M00679  BMP signaling
Disease
H00609  Persistent Mullerian duct syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    268 (AMH)
   04390 Hippo signaling pathway
    268 (AMH)
   04024 cAMP signaling pathway
    268 (AMH)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    268 (AMH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    268 (AMH)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   268 (AMH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMH_N TGF_beta
Motif
Other DBs
NCBI-GeneID: 268
NCBI-ProteinID: NP_000470
OMIM: 600957
HGNC: 464
Ensembl: ENSG00000104899
Vega: OTTHUMG00000180415
Pharos: P03971(Tbio)
UniProt: P03971
Position
19p13.3
AA seq 560 aa AA seqDB search
MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALG
GDSNGSSSPLRVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGA
WLRDPGGQRLVVLHLEEVTWEPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAG
LPGAQSLCPSRDTRYLVLAVDRPAGAWRGSGLALTLQPRGEDSRLSTARLQALLFGDDHR
CFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRA
LRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDP
APLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD
PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIP
ETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLS
EERISAHHVPNMVATECGCR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacctgcctctcaccagcctggccctagtgctgtctgccctgggggctctgctg
gggactgaggccctcagagcagaggagccagctgtgggcaccagtggcctcatcttccga
gaagacttggactggcctccaggcagcccacaagagcctctgtgcctggtggcactgggc
ggggacagcaatggcagcagctcccccctgcgggtggtgggggctctaagcgcctatgag
caggccttcctgggggccgtgcagagggcccgctggggcccccgagacctggccaccttc
ggggtctgcaacaccggtgacaggcaggctgccttgccctctctacggcggctgggggcc
tggctgcgggaccctggggggcagcgcctggtggtcctacacctggaggaagtgacctgg
gagccaacaccctcgctgaggttccaggagcccccgcctggaggagctggccccccagag
ctggcgctgctggtgctgtaccctgggcctggccctgaggtcactgtgacgagggctggg
ctgccgggtgcccagagcctctgcccctcccgagacacccgctacctggtgttagcggtg
gaccgccctgcgggggcctggcgcggctccgggctggccttgaccctgcagccccgcgga
gaggactcccggctgagtaccgcccggctgcaggcactgctgttcggcgacgaccaccgc
tgcttcacacggatgaccccggccctgctcctgctgccgcggtccgagcccgcgccgctg
cctgcgcacggccagctggacaccgtgcccttcccgccgcccaggccatccgcggaactc
gaggagtcgccacccagcgcagaccccttcctggagacgctcacgcgcctggtgcgggcg
ctgcgggtccccccggcccgggcctccgcgccgcgcctggccctggatccggacgcgctg
gccggcttcccgcagggcctagtcaacctgtcggaccccgcggcgctggagcgcctactc
gacggcgaggagccgctgctgctgctgctgaggcccactgcggccaccaccggggatcct
gcgcccctgcacgaccccacgtcggcgccgtgggccacggccctggcgcgccgcgtggct
gctgaactgcaagcggcggctgccgagctgcgaagcctcccgggtctgcctccggccaca
gccccgctgctggcgcgcctgctcgcgctctgcccaggtggccccggcggcctcggcgat
cccctgcgagcgctgctgctcctgaaggcgctgcagggcctgcgcgtggagtggcgcggg
cgggatccgcgcgggccgggtcgggcacagcgcagcgcgggggccaccgccgccgacggg
ccgtgcgcgctgcgcgagctcagcgtagacctccgcgccgagcgctccgtactcatcccc
gagacctaccaggccaacaattgccagggcgtgtgcggctggcctcagtccgaccgcaac
ccgcgctacggcaaccacgtggtgctgctgctgaagatgcaggcccgtggggccgccctg
gcgcgcccaccctgctgcgtgcccaccgcctacgcgggcaagctgctcatcagcctgtcg
gaggagcgcatcagcgcgcaccacgtgcccaacatggtggccaccgagtgtggctgccgg
tga

KEGG   Homo sapiens (human): 353500Help
Entry
353500            CDS       T01001                                 

Gene name
BMP8A
Definition
(RefSeq) bone morphogenetic protein 8a
  KO
K16622  bone morphogenetic protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04714  Thermogenesis
Module
hsa_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    353500 (BMP8A)
   04390 Hippo signaling pathway
    353500 (BMP8A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    353500 (BMP8A)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    353500 (BMP8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    353500 (BMP8A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   353500 (BMP8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 353500
NCBI-ProteinID: NP_861525
HGNC: 21650
Ensembl: ENSG00000183682
Vega: OTTHUMG00000008394
Pharos: Q7Z5Y6(Tbio)
UniProt: Q7Z5Y6
Position
1p34.3
AA seq 402 aa AA seqDB search
MAARPGPLWLLGLTLCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRP
RAPPAASRLPASAPLFMLDLYHAMAGDDDEDGAPAEQRLGRADLVMSFVNMVERDRALGH
QEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLF
FLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETEDGHSVDPGLAGLLGQRA
PRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV
CRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPN
AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgccccggaccgctctggcttctgggcctgacgttgtgcgcgctgggcggg
ggcggccccggcctgcgacccccgcccggctgtccccagcgacgtctgggcgcgcgcgag
cgccgggacgtgcagcgcgagatcctggcggtgctcgggctacccgggcggccccggccc
cgcgcgccacccgccgcctcccggctgcccgcgtccgcgccgctcttcatgctggacctg
taccacgccatggctggcgacgacgacgaggacggcgcgcccgcggagcagcgcctgggc
cgcgccgacctggtcatgagcttcgtcaacatggtggagcgagaccgtgccctgggccac
caggagccccattggaaggagttccgctttgacctgacccagatcccggctggggaggcg
gtcacagctgcggagttccggatttacaaggtgcccagcatccacctgctcaacaggacc
ctccacgtcagcatgttccaggtggtccaggagcagtccaacagggagtctgacttgttc
tttttggatcttcagacgctccgagctggagacgagggctggctggtgctggatgtcaca
gcagccagtgactgctggttgctgaagcgtcacaaggacctgggactccgcctctatgtg
gagactgaggacgggcacagcgtggatcctggcctggccggcctgctgggtcaacgggcc
ccacgctcccaacagcctttcgtggtcactttcttcagggccagtccgagtcccatccgc
acccctcgggcagtgaggccactgaggaggaggcaaccgaagaaaagcaacgagctgccg
caggccaaccgactcccagggatctttgatgacgtccgcggctcccacggccggcaggtc
tgccgtcggcacgagctctacgtcagcttccaggaccttggctggctggactgggtcatc
gccccccaaggctactcagcctattactgtgagggggagtgctccttcccgctggactcc
tgcatgaacgccaccaaccacgccatcctgcagtccctggtgcacctgatgaagccaaac
gcagtccccaaggcgtgctgtgcacccaccaagctgagcgccacctctgtgctctactat
gacagcagcaacaacgtcatcctgcgcaagcaccgcaacatggtggtcaaggcctgcggc
tgccactga

KEGG   Homo sapiens (human): 392255Help
Entry
392255            CDS       T01001                                 

Gene name
GDF6, BMP-13, BMP13, CDMP2, KFM, KFS, KFS1, KFSL, SGM1, SYNS4
Definition
(RefSeq) growth differentiation factor 6
  KO
K20012  growth differentiation factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Disease
H00837  Leber congenital amaurosis
H00852  Klippel-Feil syndrome
H01027  Microphthalmia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    392255 (GDF6)
   04390 Hippo signaling pathway
    392255 (GDF6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    392255 (GDF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    392255 (GDF6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   392255 (GDF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 392255
NCBI-ProteinID: NP_001001557
OMIM: 601147
HGNC: 4221
Ensembl: ENSG00000156466
Vega: OTTHUMG00000164710
Pharos: Q6KF10(Tbio)
UniProt: Q6KF10 A0A0S2A5D6
Position
8q22.1
AA seq 455 aa AA seqDB search
MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGMRSRKEGKMQRAPRDSDA
GREGQEPQPRPQDEPRAQQPRAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQS
SKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPP
AGPLHVQLFPCLSPLLLDARTLDPQGAPPAGWEVFDVWQGLRHQPWKQLCLELRAAWGEL
DAGEAEARARGPQQPPPPDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFAEMREQLGSA
EAAGPGAGAEGSWPPPSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKSRLRCSKKPLH
VNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCC
VPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggatactcccagggtcctgctctcggccgtcttcctcatcagttttctgtgggatttg
cccggtttccagcaggcttccatctcatcctcctcgtcgtccgccgagctgggttccacc
aagggcatgcgaagccgcaaggaaggcaagatgcagcgggcgccgcgcgacagtgacgcg
ggccgggagggccaggaaccacagccgcggcctcaggacgaaccccgggctcagcagccc
cgggcgcaggagccgccaggcaggggtccgcgcgtggtgccccacgagtacatgctgtca
atctacaggacttactccatcgctgagaagctgggcatcaatgccagctttttccagtct
tccaagtcggctaatacgatcaccagctttgtagacaggggactagacgatctctcgcac
actcctctccggagacagaagtatttgtttgatgtgtccatgctctcagacaaagaagag
ctggtgggcgcggagctgcggctctttcgccaggcgccctcagcgccctgggggccacca
gccgggccgctccacgtgcagctcttcccttgcctttcgcccctactgctggacgcgcgg
accctggacccgcagggggcgccgccggccggctgggaagtcttcgacgtgtggcagggc
ctgcgccaccagccctggaagcagctgtgcttggagctgcgggccgcatggggcgagctg
gacgccggggaggccgaggcgcgcgcgcggggaccccagcaaccgccgcccccggacctg
cggagtctgggcttcggccggagggtgcggcctccccaggagcgggccctgctggtggta
ttcaccagatcccagcgcaagaacctgttcgcagagatgcgcgagcagctgggctcggcc
gaggctgcgggcccgggcgcgggcgccgaggggtcgtggccgccgccgtcgggcgccccg
gatgccaggccttggctgccctcgcccggccgccggcggcggcgcacggccttcgccagt
cgccatggcaagcggcacggcaagaagtccaggctacgctgcagcaagaagcccctgcac
gtgaacttcaaggagctgggctgggacgactggattatcgcgcccctggagtacgaggcc
tatcactgcgagggtgtatgcgacttcccgctgcgctcgcacctggagcccaccaaccac
gccatcatccagacgctgatgaactccatggaccccggctccaccccgcccagctgctgc
gtgcccaccaaattgactcccatcagcattctatacatcgacgcgggcaataatgtggtc
tacaagcagtacgaggacatggtggtggagtcgtgcggctgcaggtag

KEGG   Homo sapiens (human): 650Help
Entry
650               CDS       T01001                                 

Gene name
BMP2, BDA2, BMP2A, SSFSC
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Module
hsa_M00679  BMP signaling
Network
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
Disease
H00482  Brachydactyly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    650 (BMP2)
   04390 Hippo signaling pathway
    650 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    650 (BMP2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    650 (BMP2)
  09162 Cancers: Specific types
   05217 Basal cell carcinoma
    650 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    650 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    650 (BMP2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   650 (BMP2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   650 (BMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 650
NCBI-ProteinID: NP_001191
OMIM: 112261
HGNC: 1069
Ensembl: ENSG00000125845
Vega: OTTHUMG00000031833
Pharos: P12643(Tbio)
UniProt: P12643 C8C060
Structure
PDB: 

Position
20p12.3
AA seq 396 aa AA seqDB search
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggctggcctcgttccggagctgggccgcaggaagttcgcggcggcgtcgtcgggccgc
ccctcatcccagccctctgacgaggtcctgagcgagttcgagttgcggctgctcagcatg
ttcggcctgaaacagagacccacccccagcagggacgccgtggtgcccccctacatgcta
gacctgtatcgcaggcactcaggtcagccgggctcacccgccccagaccaccggttggag
agggcagccagccgagccaacactgtgcgcagcttccaccatgaagaatctttggaagaa
ctaccagaaacgagtgggaaaacaacccggagattcttctttaatttaagttctatcccc
acggaggagtttatcacctcagcagagcttcaggttttccgagaacagatgcaagatgct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcgaaattccccgtgaccagacttttggacaccaggttggtgaatcagaat
gcaagcaggtgggaaagttttgatgtcacccccgctgtgatgcggtggactgcacaggga
cacgccaaccatggattcgtggtggaagtggcccacttggaggagaaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatggaaaagggcatcctctccacaaaagagaa
aaacgtcaagccaaacacaaacagcggaaacgccttaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccggggtat
cacgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcatgccattgttcagacgttggtcaactctgttaactctaagattcctaaggcatgc
tgtgtcccgacagaactcagtgctatctcgatgctgtaccttgacgagaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

KEGG   Homo sapiens (human): 652Help
Entry
652               CDS       T01001                                 

Gene name
BMP4, BMP2B, BMP2B1, MCOPS6, OFC11, ZYME
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04919  Thyroid hormone signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00679  BMP signaling
Network
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
Disease
H00516  Cleft lip and/or cleft palate
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    652 (BMP4)
   04390 Hippo signaling pathway
    652 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    652 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    652 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    652 (BMP4)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    652 (BMP4)
  09162 Cancers: Specific types
   05217 Basal cell carcinoma
    652 (BMP4)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    652 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    652 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    652 (BMP4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   652 (BMP4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   652 (BMP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 652
NCBI-ProteinID: NP_001193
OMIM: 112262
HGNC: 1071
Ensembl: ENSG00000125378
Vega: OTTHUMG00000140303
Pharos: P12644(Tchem)
UniProt: P12644 Q53XC5
Position
14q22.2
AA seq 408 aa AA seqDB search
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF
HHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINI
YEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTH
LHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctgcagatgtttgggctgcgccgccgcccgcagcctagcaagagtgccgtcattccg
gactacatgcgggatctttaccggcttcagtctggggaggaggaggaagagcagatccac
agcactggtcttgagtatcctgagcgcccggccagccgggccaacaccgtgaggagcttc
caccacgaagaacatctggagaacatcccagggaccagtgaaaactctgcttttcgtttc
ctctttaacctcagcagcatccctgagaacgaggtgatctcctctgcagagcttcggctc
ttccgggagcaggtggaccagggccctgattgggaaaggggcttccaccgtataaacatt
tatgaggttatgaagcccccagcagaagtggtgcctgggcacctcatcacacgactactg
gacacgagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagccctgcg
gtccttcgctggacccgggagaagcagccaaactatgggctagccattgaggtgactcac
ctccatcagactcggacccaccagggccagcatgtcaggattagccgatcgttacctcaa
gggagtgggaattgggcccagctccggcccctcctggtcacctttggccatgatggccgg
ggccatgccttgacccgacgccggagggccaagcgtagccctaagcatcactcacagcgg
gccaggaagaagaataagaactgccggcgccactcgctctatgtggacttcagcgatgtg
ggctggaatgactggattgtggccccaccaggctaccaggccttctactgccatggggac
tgcccctttccactggctgaccacctcaactcaaccaaccatgccattgtgcagaccctg
gtcaattctgtcaattccagtatccccaaagcctgttgtgtgcccactgaactgagtgcc
atctccatgctgtacctggatgagtatgataaggtggtactgaaaaattatcaggagatg
gtagtagagggatgtgggtgccgctga

KEGG   Homo sapiens (human): 653Help
Entry
653               CDS       T01001                                 

Gene name
BMP5
Definition
(RefSeq) bone morphogenetic protein 5
  KO
K04663  bone morphogenetic protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Module
hsa_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    653 (BMP5)
   04390 Hippo signaling pathway
    653 (BMP5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    653 (BMP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    653 (BMP5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   653 (BMP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta YkuD_2
Motif
Other DBs
NCBI-GeneID: 653
NCBI-ProteinID: NP_066551
OMIM: 112265
HGNC: 1072
Ensembl: ENSG00000112175
Vega: OTTHUMG00000014903
Pharos: P22003(Tbio)
UniProt: P22003 M9VUD0 A8K694
Position
6p12.1
AA seq 454 aa AA seqDB search
MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
LPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASP
NGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEF
RFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKA
QALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPF
MVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYV
SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgactgtatttttacttaagggtattgtgggtttcctctggagctgctgggtt
ctagtgggttatgcaaaaggaggtttgggagacaatcatgttcactccagttttatttat
agaagactacggaaccacgaaagacgggaaatacaaagggaaattctctctatcttgggt
ttgcctcacagacccagaccattttcacctggaaaacaagcgtcctctgcacctctcttt
atgctggatctctacaatgccatgaccaatgaagaaaatcctgaagagtcggagtactca
gtaagggcatccttggcagaagagaccagaggggcaagaaagggatacccagcctctccc
aatgggtatcctcgtcgcatacagttatctcggacgactcctctgaccacccagagtcct
cctctagccagcctccatgataccaactttctgaatgatgctgacatggtcatgagcttt
gtcaacttagttgaaagagacaaggatttttctcaccagcgaaggcattacaaagaattt
cgatttgatcttacccaaattcctcatggagaggcagtgacagcagctgaattccggata
tacaaggaccggagcaacaaccgatttgaaaatgaaacaattaagattagcatatatcaa
atcatcaaggaatacacaaatagggatgcagatctgttcttgttagacacaagaaaggcc
caagctttagatgtgggttggcttgtctttgatatcactgtgaccagcaatcattgggtg
attaatccccagaataatttgggcttacagctctgtgcagaaacaggggatggacgcagt
atcaacgtaaaatctgctggtcttgtgggaagacagggacctcagtcaaaacaaccattc
atggtggccttcttcaaggcgagtgaggtacttcttcgatccgtgagagcagccaacaaa
cgaaaaaatcaaaaccgcaataaatccagctctcatcaggactcctccagaatgtccagt
gttggagattataacacaagtgagcaaaaacaagcctgtaagaagcacgaactctatgtg
agcttccgggatctgggatggcaggactggattatagcaccagaaggatacgctgcattt
tattgtgatggagaatgttcttttccacttaacgcccatatgaatgccaccaaccacgct
atagttcagactctggttcatctgatgtttcctgaccacgtaccaaagccttgttgtgct
ccaaccaaattaaatgccatctctgttctgtactttgatgacagctccaatgtcattttg
aaaaaatatagaaatatggtagtacgctcatgtggctgccactaa

KEGG   Homo sapiens (human): 654Help
Entry
654               CDS       T01001                                 

Gene name
BMP6, VGR, VGR1
Definition
(RefSeq) bone morphogenetic protein 6
  KO
K16620  bone morphogenetic protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04913  Ovarian steroidogenesis
Module
hsa_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    654 (BMP6)
   04390 Hippo signaling pathway
    654 (BMP6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    654 (BMP6)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    654 (BMP6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    654 (BMP6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   654 (BMP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 654
NCBI-ProteinID: NP_001709
OMIM: 112266
HGNC: 1073
Ensembl: ENSG00000153162
Vega: OTTHUMG00000014217
Pharos: P22004(Tbio)
UniProt: P22004 Q4VBA3 B4DUF7
Structure
PDB: 

Position
6p24.3
AA seq 513 aa AA seqDB search
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSP
QSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLP
RGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAH
PLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKF
NLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWA
SEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMV
AFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS
FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAP
TKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccggggctggggcggagggcgcagtggctgtgctggtggtgggggctgctgtgcagc
tgctgcgggcccccgccgctgcggccgcccttgcccgctgccgcggccgccgccgccggg
gggcagctgctgggggacggcgggagccccggccgcacggagcagccgccgccgtcgccg
cagtcctcctcgggcttcctgtaccggcggctcaagacgcaggagaagcgggagatgcag
aaggagatcttgtcggtgctggggctcccgcaccggccccggcccctgcacggcctccaa
cagccgcagcccccggcgctccggcagcaggaggagcagcagcagcagcagcagctgcct
cgcggagagccccctcccgggcgactgaagtccgcgcccctcttcatgctggatctgtac
aacgccctgtccgccgacaacgacgaggacggggcgtcggagggggagaggcagcagtcc
tggccccacgaagcagccagctcgtcccagcgtcggcagccgcccccgggcgccgcgcac
ccgctcaaccgcaagagccttctggcccccggatctggcagcggcggcgcgtccccactg
accagcgcgcaggacagcgccttcctcaacgacgcggacatggtcatgagctttgtgaac
ctggtggagtacgacaaggagttctcccctcgtcagcgacaccacaaagagttcaagttc
aacttatcccagattcctgagggtgaggtggtgacggctgcagaattccgcatctacaag
gactgtgttatggggagttttaaaaaccaaacttttcttatcagcatttatcaagtctta
caggagcatcagcacagagactctgacctgtttttgttggacacccgtgtagtatgggcc
tcagaagaaggctggctggaatttgacatcacggccactagcaatctgtgggttgtgact
ccacagcataacatggggcttcagctgagcgtggtgacaagggatggagtccacgtccac
ccccgagccgcaggcctggtgggcagagacggcccttacgacaagcagcccttcatggtg
gctttcttcaaagtgagtgaggtgcacgtgcgcaccaccaggtcagcctccagccggcgc
cgacaacagagtcgtaatcgctctacccagtcccaggacgtggcgcgggtctccagtgct
tcagattacaacagcagtgaattgaaaacagcctgcaggaagcatgagctgtatgtgagt
ttccaagacctgggatggcaggactggatcattgcacccaagggctatgctgccaattac
tgtgatggagaatgctccttcccactcaacgcacacatgaatgcaaccaaccacgcgatt
gtgcagaccttggttcaccttatgaaccccgagtatgtccccaaaccgtgctgtgcgcca
actaagctaaatgccatctcggttctttactttgatgacaactccaatgtcattctgaaa
aaatacaggaatatggttgtaagagcttgtggatgccactaa

KEGG   Homo sapiens (human): 655Help
Entry
655               CDS       T01001                                 

Gene name
BMP7, OP-1
Definition
(RefSeq) bone morphogenetic protein 7
  KO
K16621  bone morphogenetic protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
Module
hsa_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    655 (BMP7)
   04390 Hippo signaling pathway
    655 (BMP7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    655 (BMP7)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    655 (BMP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    655 (BMP7)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    655 (BMP7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   655 (BMP7)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   655 (BMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 655
NCBI-ProteinID: NP_001710
OMIM: 112267
HGNC: 1074
Ensembl: ENSG00000101144
Vega: OTTHUMG00000032812
Pharos: P18075(Tbio)
UniProt: P18075 A8K571
Structure
PDB: 

Position
20q13.31
AA seq 431 aa AA seqDB search
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgcgctcactgcgagctgcggcgccgcacagcttcgtggcgctctgggcaccc
ctgttcctgctgcgctccgccctggccgacttcagcctggacaacgaggtgcactcgagc
ttcatccaccggcgcctccgcagccaggagcggcgggagatgcagcgcgagatcctctcc
attttgggcttgccccaccgcccgcgcccgcacctccagggcaagcacaactcggcaccc
atgttcatgctggacctgtacaacgccatggcggtggaggagggcggcgggcccggcggc
cagggcttctcctacccctacaaggccgtcttcagtacccagggcccccctctggccagc
ctgcaagatagccatttcctcaccgacgccgacatggtcatgagcttcgtcaacctcgtg
gaacatgacaaggaattcttccacccacgctaccaccatcgagagttccggtttgatctt
tccaagatcccagaaggggaagctgtcacggcagccgaattccggatctacaaggactac
atccgggaacgcttcgacaatgagacgttccggatcagcgtttatcaggtgctccaggag
cacttgggcagggaatcggatctcttcctgctcgacagccgtaccctctgggcctcggag
gagggctggctggtgtttgacatcacagccaccagcaaccactgggtggtcaatccgcgg
cacaacctgggcctgcagctctcggtggagacgctggatgggcagagcatcaaccccaag
ttggcgggcctgattgggcggcacgggccccagaacaagcagcccttcatggtggctttc
ttcaaggccacggaggtccacttccgcagcatccggtccacggggagcaaacagcgcagc
cagaaccgctccaagacgcccaagaaccaggaagccctgcggatggccaacgtggcagag
aacagcagcagcgaccagaggcaggcctgtaagaagcacgagctgtatgtcagcttccga
gacctgggctggcaggactggatcatcgcgcctgaaggctacgccgcctactactgtgag
ggggagtgtgccttccctctgaactcctacatgaacgccaccaaccacgccatcgtgcag
acgctggtccacttcatcaacccggaaacggtgcccaagccctgctgtgcgcccacgcag
ctcaatgccatctccgtcctctacttcgatgacagctccaacgtcatcctgaagaaatac
agaaacatggtggtccgggcctgtggctgccactag

KEGG   Homo sapiens (human): 656Help
Entry
656               CDS       T01001                                 

Gene name
BMP8B, BMP8, OP2
Definition
(RefSeq) bone morphogenetic protein 8b
  KO
K16622  bone morphogenetic protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04714  Thermogenesis
Module
hsa_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    656 (BMP8B)
   04390 Hippo signaling pathway
    656 (BMP8B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    656 (BMP8B)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    656 (BMP8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    656 (BMP8B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   656 (BMP8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 656
NCBI-ProteinID: NP_001711
OMIM: 602284
HGNC: 1075
Ensembl: ENSG00000116985
Vega: OTTHUMG00000009247
Pharos: P34820(Tbio)
UniProt: P34820
Position
1p34.2
AA seq 402 aa AA seqDB search
MTALPGPLWLLGLALCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRP
RAPPAASRLPASAPLFMLDLYHAMAGDDDEDGAPAERRLGRADLVMSFVNMVERDRALGH
QEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLF
FLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETEDGHSVDPGLAGLLGQRA
PRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQV
CRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPD
AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctccccggcccgctctggctcctgggcctggcgctatgcgcgctgggcggg
ggcggccccggcctgcgacccccgcccggctgtccccagcgacgtctgggcgcgcgcgag
cgccgggacgtgcagcgcgagatcctggcggtgctcgggctgcctgggcggccccggccc
cgcgcgccacccgccgcctcccggctgcccgcgtccgcgccgctcttcatgctggacctg
taccacgccatggccggcgacgacgacgaggacggcgcgcccgcggagcggcgcctgggc
cgcgccgacctggtcatgagcttcgttaacatggtggagcgagaccgtgccctgggccac
caggagccccattggaaggagttccgctttgacctgacccagatcccggctggggaggcg
gtcacagctgcggagttccggatttacaaggtgcccagcatccacctgctcaacaggacc
ctccacgtcagcatgttccaggtggtccaggagcagtccaacagggagtctgacttgttc
tttttggatcttcagacgctccgagctggagacgagggctggctggtgctggatgtcaca
gcagccagtgactgctggttgctgaagcgtcacaaggacctgggactccgcctctatgtg
gagactgaggacgggcacagcgtggatcctggcctggccggcctgctgggtcaacgggcc
ccacgctcccaacagcctttcgtggtcactttcttcagggccagtccgagtcccatccgc
acccctcgggcagtgaggccactgaggaggaggcagccgaagaaaagcaacgagctgccg
caggccaaccgactcccagggatctttgatgacgtccacggctcccacggccggcaggtc
tgccgtcggcacgagctctacgtcagcttccaggacctcggctggctggactgggtcatc
gctccccaaggctactcggcctattactgtgagggggagtgctccttcccactggactcc
tgcatgaatgccaccaaccacgccatcctgcagtccctggtgcacctgatgatgccagac
gcagtccccaaggcgtgctgtgcacccaccaagctgagcgccacctctgtgctctactat
gacagcagcaacaatgtcatcctgcgcaagcaccgcaacatggtggtcaaggcctgcggc
tgccactga

KEGG   Homo sapiens (human): 8200Help
Entry
8200              CDS       T01001                                 

Gene name
GDF5, BDA1C, BMP-14, BMP14, CDMP1, LAP-4, LAP4, OS5, SYM1B, SYNS2
Definition
(RefSeq) growth differentiation factor 5
  KO
K04664  growth differentiation factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Module
hsa_M00679  BMP signaling
Disease
H00466  Grebe dysplasia
H00467  Fibular hypoplasia and complex brachydactyly
H00482  Brachydactyly
H00483  Angel shaped phalangoepiphyseal dysplasia
H00484  Multiple synostosis syndrome
H00851  Proximal symphalangism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    8200 (GDF5)
   04390 Hippo signaling pathway
    8200 (GDF5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8200 (GDF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    8200 (GDF5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   8200 (GDF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 8200
NCBI-ProteinID: NP_000548
OMIM: 601146
HGNC: 4220
Ensembl: ENSG00000125965
Vega: OTTHUMG00000032341
Pharos: P43026(Tbio)
UniProt: P43026 F1T0J1
Structure
PDB: 

Position
20q11.22
AA seq 501 aa AA seqDB search
MRLPKLLTFLLWYLAWLDLEFICTVLGAPDLGQRPQGTRPGLAKAEAKERPPLARNVFRP
GGHSYGGGATNANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATAR
TVTPKGQLPGGKAPPKAGSVPSSFLLKKAREPGPPREPKEPFRPPPITPHEYMLSLYRTL
SDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKDGLLGAELR
ILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLF
RNFKNSAQLCLELEAWERGRAVDLRGLGFDRAARQVHEKALFLVFGRTKKRDLFFNEIKA
RSGQDDKTVYEYLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIA
PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFID
SANNVVYKQYEDMVVESCGCR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagactccccaaactcctcactttcttgctttggtacctggcttggctggacctggaa
ttcatctgcactgtgttgggtgcccctgacttgggccagagaccccaggggaccaggcca
ggattggccaaagcagaggccaaggagaggccccccctggcccggaacgtcttcaggcca
gggggtcacagctatggtgggggggccaccaatgccaatgccagggcaaagggaggcacc
gggcagacaggaggcctgacacagcccaagaaggatgaacccaaaaagctgccccccaga
ccgggcggccctgaacccaagccaggacaccctccccaaacaaggcaggctacagcccgg
actgtgaccccaaaaggacagcttcccggaggcaaggcacccccaaaagcaggatctgtc
cccagctccttcctgctgaagaaggccagggagcccgggcccccacgagagcccaaggag
ccgtttcgcccaccccccatcacaccccacgagtacatgctctcgctgtacaggacgctg
tccgatgctgacagaaagggaggcaacagcagcgtgaagttggaggctggcctggccaac
accatcaccagctttattgacaaagggcaagatgaccgaggtcccgtggtcaggaagcag
aggtacgtgtttgacattagtgccctggagaaggatgggctgctgggggccgagctgcgg
atcttgcggaagaagccctcggacacggccaagccagcggcccccggaggcgggcgggct
gcccagctgaagctgtccagctgccccagcggccggcagccggccgccttgctggatgtg
cgctccgtgccaggcctggacggatctggctgggaggtgttcgacatctggaagctcttc
cgaaactttaagaactcggcccagctgtgcctggagctggaggcctgggaacggggcagg
gccgtggacctccgtggcctgggcttcgaccgcgccgcccggcaggtccacgagaaagcc
ctgttcctggtgtttggccgcaccaagaaacgggacctgttctttaatgagattaaggcc
cgctctggccaggacgataagaccgtgtatgagtacctgttcagccagcggcgaaaacgg
cgggccccactggccactcgccagggcaagcgacccagcaagaaccttaaggctcgctgc
agtcggaaggcactgcatgtcaacttcaaggacatgggctgggacgactggatcatcgca
ccccttgagtacgaggctttccactgcgaggggctgtgcgagttcccattgcgctcccac
ctggagcccacgaatcatgcagtcatccagaccctgatgaactccatggaccccgagtcc
acaccacccacctgctgtgtgcccacgcggctgagtcccatcagcatcctcttcattgac
tctgccaacaacgtggtgtataagcagtatgaggacatggtcgtggagtcgtgtggctgc
aggtag

DBGET integrated database retrieval system