KEGG   Homo sapiens (human): 1515Help
Entry
1515              CDS       T01001                                 

Gene name
CTSV, CATL2, CTSL2, CTSU
Definition
(RefSeq) cathepsin V
  KO
K01375  cathepsin V [EC:3.4.22.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1515 (CTSV)
  09143 Cell growth and death
   04210 Apoptosis
    1515 (CTSV)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1515 (CTSV)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.43  cathepsin V
     1515 (CTSV)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C1: papain family
   1515 (CTSV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Styelin
Motif
Other DBs
NCBI-GeneID: 1515
NCBI-ProteinID: NP_001188504
OMIM: 603308
HGNC: 2538
Ensembl: ENSG00000136943
Vega: OTTHUMG00000020314
Pharos: O60911(Tchem)
UniProt: O60911 A0A024R141 B2R717
Structure
PDB: 

Position
9q22.33
AA seq 334 aa AA seqDB search
MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIE
LHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDW
RKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNG
GFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAV
ATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVK
NSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttcgctcgtcctggctgccttttgcttgggaatagcctccgctgttccaaaa
tttgaccaaaatttggatacaaagtggtaccagtggaaggcaacacacagaagattatat
ggcgcgaatgaagaaggatggaggagagcagtgtgggaaaagaatatgaaaatgattgaa
ctgcacaatggggaatacagccaagggaaacatggcttcacaatggccatgaatgctttt
ggtgacatgaccaatgaagaattcaggcagatgatgggttgctttcgaaaccagaaattc
aggaaggggaaagtgttccgtgagcctctgtttcttgatcttcccaaatctgtggattgg
agaaagaaaggctacgtgacgccagtgaagaatcagaaacagtgtggttcttgttgggct
tttagtgcgactggtgctcttgaaggacagatgttccggaaaactgggaaacttgtctca
ctgagcgagcagaatctggtggactgttcgcgtcctcaaggcaatcagggctgcaatggt
ggcttcatggctagggccttccagtatgtcaaggagaacggaggcctggactctgaggaa
tcctatccatatgtagcagtggatgaaatctgtaagtacagacctgagaattctgttgct
aatgacactggcttcacagtggtcgcacctggaaaggagaaggccctgatgaaagcagtc
gcaactgtggggcccatctccgttgctatggatgcaggccattcgtccttccagttctac
aaatcaggcatttattttgaaccagactgcagcagcaaaaacctggatcatggtgttctg
gtggttggctacggctttgaaggagcaaattcgaataacagcaagtattggctcgtcaaa
aacagctggggtccagaatggggctcgaatggctatgtaaaaatagccaaagacaagaac
aaccactgtggaatcgccacagcagccagctaccccaatgtgtga

DBGET integrated database retrieval system