KEGG   Homo sapiens (human): 152
Entry
152               CDS       T01001                                 

Gene name
ADRA2C, ADRA2L2, ADRA2RL2, ADRARL2, ALPHA2CAR
Definition
(RefSeq) adrenoceptor alpha 2C
  KO
K04140  adrenergic receptor alpha-2C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Apraclonidine (DG01130): D01008<JP/US> D07461
Aptazapine maleate: D02972
Atipamezole: D03002
Betanidine: D01603
Brimonidine (DG00442): D02076<JP/US> D07540
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Clonidine (DG00249): D00281<US> D00604<JP/US>
Clozapine: D00283<JP/US>
Delequamine hydrochloride: D03672
Detomidine (DG01318): D03702 D07795
Dexmedetomidine (DG00926): D00514 D01205<JP/US>
Dihydroergocristine (DG00284): D07833 D07834
Dipivefrine (DG01129): D01017<JP> D02349
Domazoline fumarate: D03887
Droxidopa: D01277<JP/US>
Ephedrine (DG00227): D00124 D01386<JP> D04018<US>
Epinephrine (DG00013): D00095<JP/US> D00996 D02149
Epinephryl borate: D04026
Ergoloid mesylates: D02268
Ergometrine (DG00446): D01163<JP> D07905
Etilefrine (DG00210): D01573<JP> D07931
Fadolmidine hydrochloride: D04124
Fluparoxan hydrochloride: D04223
Guanabenz (DG01230): D00605<JP> D04375
Guanadrel: D08029
Guanadrel sulfate: D00607
Levonordefrin: D02388
Lidamidine (DG02870): D02407 D08126
Lofexidine (DG01001): D04765<US> D08141
Medetomidine (DG01320): D04883 D08165
Metaraminol (DG00218): D01019 D08192
Methyldopa (levorotatory) (DG00248): D00405<JP/US> D08205
Methylephedrine (DG01229): D01952 D02109<JP> D08206 D09842
Methylergometrine (DG00445): D00680<JP/US> D08207
Mianserin (DG00951): D01358<JP> D08216
Mirtazapine (DG02838): D00563<JP/US> D11056
Moxonidine: D05087
Napamezole hydrochloride: D05119
Norepinephrine (DG00212): D00076<JP> D05206<US> D08284 D09794
Octodrine: D05228
Phenoxybenzamine (DG00285): D00507<US> D08358
Phentolamine (DG00280): D00509<JP/US> D08362
Phenylpropanolamine (DG01041): D01224 D05466 D08368
Propylhexedrine (DG01919): D05637 D08444
Pseudoephedrine (DG01042): D00485 D05648 D05649 D08449
Racephedrine Hydrochloride: D08982
Racepinephrine (DG01444): D05688 D05689
Rilmenidine: D08482
Romifidine: D08487
Setiptiline (DG01231): D02034<JP> D08511
Sunepitron hydrochloride: D02569
Tizanidine (DG00773): D00776<JP/US> D08611
Tolazoline (DG00281): D00997 D08614
Tramazoline (DG01033): D01347<JP> D08624
Vatinoxan (DG02987): D11320 D11321
Xylazine (DG01321): D06344 D08683
Xylometazoline (DG01031): D00757 D08684
Yohimbin (DG00485): D06671 D08685
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    152 (ADRA2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    152 (ADRA2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    152 (ADRA2C)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    152 (ADRA2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 152
NCBI-ProteinID: NP_000674
OMIM: 104250
HGNC: 283
Ensembl: ENSG00000184160
Vega: OTTHUMG00000159830
Pharos: P18825(Tclin)
UniProt: P18825 Q4W594
Position
4p16.3
AA seq 462 aa
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggcgtccccggcgctggcggcggcgctggcggtggcggcagcggcgggccccaatgcg
agcggcgcgggcgagaggggcagcggcggggttgccaatgcctcgggggcttcctggggg
ccgccgcgcggccagtactcggcgggcgcggtggcagggctggctgccgtggtgggcttc
ctcatcgtcttcaccgtggtgggcaacgtgctggtggtgatcgccgtgctgaccagccgg
gcgctgcgcgcgccacagaacctcttcctggtgtcgctggcctcggccgacatcctggtg
gccacgctggtcatgcccttctcgttggccaacgagctcatggcctactggtacttcggg
caggtgtggtgcggcgtgtacctggcgctcgatgtgctgttttgcacctcgtcgatcgtg
catctgtgtgccatcagcctggaccgctactggtcggtgacgcaggccgtcgagtacaac
ctgaagcgcacaccacgccgcgtcaaggccaccatcgtggccgtgtggctcatctcggcc
gtcatctccttcccgccgctggtctcgctctaccgccagcccgacggcgccgcctacccg
cagtgcggcctcaacgacgagacctggtacatcctgtcctcctgcatcggctccttcttc
gcgccctgcctcatcatgggcctggtctacgcgcgcatctaccgagtggccaagctgcgc
acgcgcacgctcagcgagaagcgcgcccccgtgggccccgacggtgcgtccccgactacc
gaaaacgggctgggcgcggcggcaggcgcaggcgagaacgggcactgcgcgcccccgccc
gccgacgtggagccggacgagagcagcgcagcggccgagaggcggcggcgccggggcgcg
ttgcggcggggcgggcggcggcgagcgggcgcggaggggggcgcgggcggtgcggacggg
cagggggcggggccgggggcggctgagtcgggggcgctgaccgcctccaggtccccgggg
cccggtggccgcctgtcgcgcgccagctcgcgctccgtcgagttcttcctgtcgcgccgg
cgccgggcgcgcagcagcgtgtgccgccgcaaggtggcccaggcgcgcgagaagcgcttc
acctttgtgctggctgtggtcatgggcgtgttcgtgctctgctggttccccttcttcttc
agctacagcctgtacggcatctgccgcgaggcctgccaggtgcccggcccgctcttcaag
ttcttcttctggatcggctactgcaacagctcgctcaacccggtcatctacacggtcttc
aaccaggatttccggcgatcctttaagcacatcctcttccgacggaggagaaggggcttc
aggcagtga

DBGET integrated database retrieval system