KEGG   Homo sapiens (human): 152007Help
Entry
152007            CDS       T01001                                 

Gene name
GLIPR2, C9orf19, GAPR-1, GAPR1
Definition
(RefSeq) GLI pathogenesis related 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 152007
NCBI-ProteinID: NP_071738
OMIM: 607141
HGNC: 18007
Ensembl: ENSG00000122694
Vega: OTTHUMG00000019900
Pharos: Q9H4G4(Tbio)
UniProt: Q9H4G4
Structure
PDB: 

Position
9p13.3
AA seq 154 aa AA seqDB search
MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSR
GQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKA
SASDGSSFVVARYFPAGNVVNEGFFEENVLPPKK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtcagcttccaaacagtttcataatgaggtcctgaaggcccacaatgagtac
cggcagaagcacggcgtccccccactgaagctctgcaagaacctcaaccgggaggctcaa
cagtattctgaggccctggccagcacgaggatcctcaagcacagcccggagtccagccgt
ggccagtgtggggagaaccttgcatgggcatcctatgatcagacaggaaaggaggtggct
gatagatggtacagtgaaatcaagaactataacttccagcagcctggcttcacctcgggg
actggacacttcacggccatggtatggaagaacaccaagaagatgggcgtggggaaggcg
tccgcaagtgacgggtcctcctttgtggtggccagatacttcccagcggggaatgttgtc
aatgagggcttcttcgaagaaaacgtcctgccgccgaagaagtaa

DBGET integrated database retrieval system