KEGG   Homo sapiens (human): 152015Help
Entry
152015            CDS       T01001                                 

Gene name
ROPN1B
Definition
(RefSeq) rhophilin associated tail protein 1B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RIIa
Motif
Other DBs
NCBI-GeneID: 152015
NCBI-ProteinID: NP_001012337
HGNC: 31927
Ensembl: ENSG00000114547
Vega: OTTHUMG00000162651
Pharos: Q9BZX4(Tbio)
UniProt: Q9BZX4 A0A140VKG6
Position
3q21.2
AA seq 212 aa AA seqDB search
MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVA
LCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHV
SRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctcagacagataagccaacatgcatcccgccggagctgccgaaaatgctgaaggag
tttgccaaagccgccattcgggcgcagccgcaggacctcatccagtggggggccgattat
tttgaggccctgtcccgtggagagacgcctccggtgagagagcggtctgagcgagtcgct
ttgtgtaactgggcagagctaacacctgagctgttaaagatcctgcattctcaggttgct
ggcagactgatcatccgtgcagaggagctggcccagatgtggaaagtggtgaatctccca
acagatctgtttaatagtgtgatgaatgtgggtcgcttcacggaggagatcgagtggctg
aagtttttagcccttgcttgcagcgctctgggagttactattaccaaaactctcaagata
gtgtgtgaggtcttatcatgtgaccacaatggtgggttgccccgaatcccattcagcacc
ttccagtttctctacacgtatattgccgaagtggatggggagatctgtgcatcacatgtc
agcaggatgctaaactacattgaacaggaagtaattggtcctgatggtttaatcacggtg
aatgactttacccaaaaccccagggtttggctggagtaa

DBGET integrated database retrieval system