KEGG   Homo sapiens (human): 1521
Entry
1521              CDS       T01001                                 

Gene name
CTSW, LYPN
Definition
(RefSeq) cathepsin W
  KO
K08569  cathepsin W [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1521 (CTSW)
  09143 Cell growth and death
   04210 Apoptosis
    1521 (CTSW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1521 (CTSW)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     1521 (CTSW)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C1: papain family
   1521 (CTSW)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 1521
NCBI-ProteinID: NP_001326
OMIM: 602364
HGNC: 2546
Ensembl: ENSG00000172543
Vega: OTTHUMG00000166663
Pharos: P56202(Tbio)
UniProt: P56202
Position
11q13.1
AA seq 376 aa
MALTAHPSCLLALLVAGLAQGIRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHA
HRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIR
SEEPEESVPFSCDWRKVASAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQE
LLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDF
IMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGS
VKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLT
ARVQKPDMKPRVSCPP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcactgactgcccacccctcctgcctcctggccctgttggtggcaggcctagcccaa
ggcatcagaggcccccttagggcccaggacctaggtccccagccgctagagctgaaagag
gccttcaagttgttccagatccagttcaaccggagttacctgagcccagaagagcatgct
caccgcctggacatctttgcccacaacctggcccaggctcagaggctgcaggaggaggac
ttgggcacagctgagtttggggtgactccattcagtgacctcacagaggaggagtttggc
cagctctatggctatcggagggcagctggaggggtccccagcatgggcagagaaataagg
tctgaagagccagaggagtcagtacctttcagctgtgactggcggaaggtggccagcgcc
atctcacccatcaaggaccagaaaaactgcaactgctgctgggccatggcagcggcaggc
aacatagagaccctgtggcgcatcagtttctgggattttgtggatgtctccgtgcaggaa
ctgctggactgtggccgctgtggggatggctgccacggtggcttcgtctgggacgcgttc
ataactgtcctcaacaacagcggcctggccagtgaaaaggactacccgttccagggcaaa
gtcagagcccacaggtgccaccccaagaagtaccagaaggtggcctggatccaggacttc
atcatgctgcagaacaacgagcacagaattgcgcagtacctggccacttatggccccatc
accgtgaccatcaacatgaagccccttcagctataccggaaaggtgtgatcaaggccaca
cccaccacctgtgacccccagcttgtggaccactctgtcctgctggtgggttttggcagc
gtcaagtcagaggaggggatatgggcagagacagtctcatcgcagtctcagcctcagcct
ccacaccccaccccatactggatcctgaagaactcctggggggcccaatggggagagaag
ggctatttccggctgcaccgagggagcaatacctgtggcatcaccaagttcccgctcact
gcccgtgtgcagaaaccggatatgaagccccgagtctcctgccctccctga

DBGET integrated database retrieval system