KEGG   Homo sapiens (human): 152138Help
Entry
152138            CDS       T01001                                 

Gene name
PYDC2, POP2, cPOP2
Definition
(RefSeq) pyrin domain containing 2
  KO
K20911  pyrin domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    152138 (PYDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PYRIN
Motif
Other DBs
NCBI-GeneID: 152138
NCBI-ProteinID: NP_001076777
OMIM: 615701
HGNC: 33512
Ensembl: ENSG00000253548
Pharos: Q56P42(Tbio)
UniProt: Q56P42
Position
3q28
AA seq 97 aa AA seqDB search
MASSAELDFNLQALLEQLSQDELSKFKSLIRTISLGKELQTVPQTEVDKANGKQLVEIFT
SHSCSYWAGMAAIQVFEKMNQTHLSGRADEHCVMPPP
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttctgcagagctggacttcaacctgcaggctcttctggagcagctcagccag
gatgagttgagcaagttcaagtctctgatcagaacaatctccctgggaaaggagctacag
accgtcccccagacagaggtagacaaggctaatgggaagcaactggtagaaatcttcacc
agccactcctgcagctactgggcagggatggcagccatccaggtctttgaaaagatgaat
caaacgcatctgtctgggagagctgatgaacactgtgtgatgcccccaccttaa

DBGET integrated database retrieval system